ATP6V1G3 Antibody

Images

 
Western Blot: ATP6V1G3 Antibody [NBP2-87056] - Host: Rabbit. Target Name: Atp6v1g3. Sample Type: Mouse Spleen lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Mu, Hu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1G3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse ATP6V1G3. Peptide sequence: MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQ The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Canine (93%), Equine (100%), Rabbit (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1G3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1G3 Antibody

  • ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
  • H+ transporting, lysosomal (vacuolar proton pump) subunit G3
  • MGC119810
  • MGC119813
  • vacuolar ATP synthase subunit G 3
  • vacuolar proton pump G subunit 3
  • Vacuolar proton pump subunit G 3
  • vacuolar proton pump, subunit G3
  • V-ATPase 13 kDa subunit 3
  • V-ATPase G subunit 3
  • V-ATPase G3 subunit
  • V-ATPase subunit G 3
  • V-type proton ATPase subunit G 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49059
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP2-00580
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15520
Species: Hu, Mu, Rt, Ma-Op
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58586
Species: Hu
Applications: WB, ICC/IF
NBP2-87056
Species: Mu, Hu, Rt, Ca, Eq, Gp, Rb
Applications: WB

Publications for ATP6V1G3 Antibody (NBP2-87056) (0)

There are no publications for ATP6V1G3 Antibody (NBP2-87056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1G3 Antibody (NBP2-87056) (0)

There are no reviews for ATP6V1G3 Antibody (NBP2-87056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1G3 Antibody (NBP2-87056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP6V1G3 Products

Bioinformatics Tool for ATP6V1G3 Antibody (NBP2-87056)

Discover related pathways, diseases and genes to ATP6V1G3 Antibody (NBP2-87056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1G3 Antibody (NBP2-87056)

Discover more about diseases related to ATP6V1G3 Antibody (NBP2-87056).
 

Pathways for ATP6V1G3 Antibody (NBP2-87056)

View related products by pathway.

Blogs on ATP6V1G3

There are no specific blogs for ATP6V1G3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1G3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1G3