ATP6V1G3 Antibody - Azide and BSA Free

Western Blot: ATP6V1G3 Antibody [H00127124-B01P] - Analysis of ATP6V1G3 expression in transfected 293T cell line by ATP6V1G3 polyclonal antibody. Lane 1: ATP6V1G3 transfected lysate(12.98 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP6V1G3 Antibody - Azide and BSA Free Summary

• Immunogen: ATP6V1G3 (NP_573569.1, 1 a.a. - 118 a.a.) full-length human protein. MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
• Specificity: ATP6V1G3 - ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ATP6V1G3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V1G3 Antibody - Azide and BSA Free

• ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
• ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
• ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
• H+ transporting, lysosomal (vacuolar proton pump) subunit G3
• MGC119810
• MGC119813
• vacuolar ATP synthase subunit G 3
• vacuolar proton pump G subunit 3
• Vacuolar proton pump subunit G 3
• vacuolar proton pump, subunit G3
• V-ATPase 13 kDa subunit 3
• V-ATPase G subunit 3
• V-ATPase G3 subunit
• V-ATPase subunit G 3
• V-type proton ATPase subunit G 3

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V1G3
• Entrez:
  • 127124(Human)
• Uniprot:
  • NP_573569.1(Human)