ATP6V0C Antibody - BSA Free

Western Blot: ATP6V0C Antibody [NBP1-59654] - Human Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: ATP6V0C Antibody [NBP1-59654] - Human ACHN cells.

Western Blot: ATP6V0C Antibody [NBP1-59654] - Human OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP6V0C Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human ATP6V0C (NP_001685). Peptide sequence VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6V0C Antibody - BSA Free

• ATP6CATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD
• ATP6LVPPC
• ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
• ATPL
• H(+)-transporting two-sector ATPase, 16 kDa subunit
• vacuolar ATP synthase 16 kDa proteolipid subunit
• vacuolar H+ ATPase proton channel subunit
• Vacuolar proton pump 16 kDa proteolipid subunit
• VATL
• V-ATPase 16 kDa proteolipid subunit
• Vma3
• V-type proton ATPase 16 kDa proteolipid subunit

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is part of the V0 domain. This gene had the previous symbols of ATP6C and ATP6L.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0C Antibody (NBP1-59654)(7)

Publications using NBP1-59654

• Qu Q, Chen Y, Wang Y, Wang W et Al. Lithocholic acid binds TULP3 to activate sirtuins and AMPK to slow down ageing Nature 2024-12-18 [PMID: 39695235]
• Delong Meng, Qianmei Yang, Mi-Hyeon Jeong, Adna Curukovic, Shweta Tiwary, Chase H. Melick, Tshering D. Lama-Sherpa, Huanyu Wang, Mariela Huerta-Rosario, Greg Urquhart, Lauren G. Zacharias, Cheryl Lewis, Ralph J. DeBerardinis, Jenna L. Jewell SNAT7 regulates mTORC1 via macropinocytosis Proceedings of the National Academy of Sciences of the United States of America 2022-05-13 [PMID: 35561222]
• Ma T, Tian X, Zhang B et al. Low-dose metformin targets the lysosomal AMPK pathway through PEN2 Nature 2022-03-01 [PMID: 35197629] (WB, Mouse)
• Weber RA, Yen FS, Nicholson SPV et al. Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation Mol. Cell 2020-01-15 [PMID: 31983508] (WB, Human)
• Li M, Zhang CS, Zong Y et al. Transient Receptor Potential V Channels Are Essential for Glucose Sensing by Aldolase and AMPK Virchows Arch. 2019-06-10 [PMID: 31204282]
• Merk H, Messer P, Ardelt MA et al. Inhibition of the V-ATPase by Archazolid A - a new strategy to inhibit EMT. Mol. Cancer Ther. 2017-08-03 [PMID: 28775146] (WB)
• Zhang CS, Li M, Ma T et al. Metformin Activates AMPK through the Lysosomal Pathway. Cell Metab 2016-10-11 [PMID: 27732831]

Bioinformatics

• Gene Symbol: ATP6V0C
• Entrez:
  • 527(Human)
• Uniprot:
  • P27449(Human)