ATP6V0B Antibody

Western Blot: ATP6V0B Antibody [NBP2-83943] - Host: Rabbit. Target Name: Atp6v0b. Sample Type: Rat Testis lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

ATP6V0B Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat ATP6V0B. Peptide sequence: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6V0B Antibody

• ATP6FH(+)-transporting two-sector ATPase, subunit F
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) 21kD
• ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b
• ATPase, H+ transporting, lysosomal 21kDa, V0 subunit c''
• HATPL
• vacuolar ATP synthase 21 kDa proteolipid subunit
• Vacuolar proton pump 21 kDa proteolipid subunit
• vacuolar proton pump, 21 kDa subunit
• V-ATPase 21 kDa proteolipid subunit
• V-ATPase subunit c''
• VMA16
• V-type proton ATPase 21 kDa proteolipid subunit

Background

The ATP6V0B gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification ofeukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellularprocesses as protein sortin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0B Antibody (NBP2-83943)(1)

Publication using NBP2-83943

• lee Y, Choi C, Jeong Y et al. TM4SF19-mediated brake of macrophage efferocytosis contributes to obesity-induced inflammation of adipose tissue Research Square 2023-04-24 (WB)

Bioinformatics

• Gene Symbol: ATP6V0B