Reactivity | Rt, Hu, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat ATP6V0B. Peptide sequence: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Human (100%), Mouse (100%), Rabbit (93%), Bovine (100%), Guinea Pig (93%), Canine (93%), Equine (93%). Backed by our 100% Guarantee. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ATP6V0B |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for ATP6V0B Antibody (NBP2-83943)Discover more about diseases related to ATP6V0B Antibody (NBP2-83943).
| Pathways for ATP6V0B Antibody (NBP2-83943)View related products by pathway.
|
PTMs for ATP6V0B Antibody (NBP2-83943)Learn more about PTMs related to ATP6V0B Antibody (NBP2-83943).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ATP6V0B |