ATP6V0B Antibody

Images

 
Western Blot: ATP6V0B Antibody [NBP2-83943] - Host: Rabbit. Target Name: Atp6v0b. Sample Type: Rat Testis lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Rt, Hu, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V0B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat ATP6V0B. Peptide sequence: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Mouse (100%), Rabbit (93%), Bovine (100%), Guinea Pig (93%), Canine (93%), Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V0B Antibody

  • ATP6FH(+)-transporting two-sector ATPase, subunit F
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 21kD
  • ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b
  • ATPase, H+ transporting, lysosomal 21kDa, V0 subunit c''
  • HATPL
  • vacuolar ATP synthase 21 kDa proteolipid subunit
  • Vacuolar proton pump 21 kDa proteolipid subunit
  • vacuolar proton pump, 21 kDa subunit
  • V-ATPase 21 kDa proteolipid subunit
  • V-ATPase subunit c''
  • VMA16
  • V-type proton ATPase 21 kDa proteolipid subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-59654
Species: Hu
Applications: WB
NBP2-58586
Species: Hu
Applications: WB, ICC/IF
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2425
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB7619
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48251
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-55232
Species: Hu
Applications: WB, ICC/IF
NBP1-54376
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03498
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009114-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38512
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-83943
Species: Rt, Hu, Mu, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for ATP6V0B Antibody (NBP2-83943) (0)

There are no publications for ATP6V0B Antibody (NBP2-83943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0B Antibody (NBP2-83943) (0)

There are no reviews for ATP6V0B Antibody (NBP2-83943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0B Antibody (NBP2-83943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP6V0B Products

Bioinformatics Tool for ATP6V0B Antibody (NBP2-83943)

Discover related pathways, diseases and genes to ATP6V0B Antibody (NBP2-83943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0B Antibody (NBP2-83943)

Discover more about diseases related to ATP6V0B Antibody (NBP2-83943).
 

Pathways for ATP6V0B Antibody (NBP2-83943)

View related products by pathway.

PTMs for ATP6V0B Antibody (NBP2-83943)

Learn more about PTMs related to ATP6V0B Antibody (NBP2-83943).

Blogs on ATP6V0B

There are no specific blogs for ATP6V0B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0B