PCP4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Staining in human cerebral cortex and liver tissues . Corresponding PCP4 RNA-seq data are presented for the same tissues.

Immunohistochemistry: PCP4 Antibody [NBP1-80929] - Staining of mouse cerebral cortex shows strong positivity in the deep layers neurons.

Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Staining of human cerebral cortex shows moderate cytoplasmic positivity.

Immunohistochemistry: PCP4 Antibody [NBP1-80929] - Staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PCP4 Antibody - BSA Free (NBP1-80929) is a polyclonal antibody validated for use in IHC. Anti-PCP4 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PCP4 Protein (NBP1-80929PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26214372).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PCP4 Antibody - BSA Free

• brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4
• Brain-specific polypeptide PEP-19
• PEP19
• PEP-19
• Purkinje cell protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCP4 Antibody (NBP1-80929)(8)

Publications using NBP1-80929

• Manuel Valero, Elena Cid, Robert G Averkin et al. Determinants of different deep and superficial CA1 pyramidal cell dynamics during sharp-wave ripples. Nature Neuroscience 2015-07-27 [PMID: 26214372] (IF/IHC, Rat)
• Zhou J, Shaikh LH, Neogi SG et al. DACH1, a Zona Glomerulosa Selective Gene in the Human Adrenal, Activates Transforming Growth Factor--beta Signaling and Suppresses Aldosterone Secretion. Hypertension 2015-05-01 [PMID: 25776071] (IF/IHC, Human)
• Botcher NA, Falck JE, Thomson AM, Mercer A. Distribution of interneurons in the CA2 region of the rat hippocampus. Front Neuroanat 2014-01-01 [PMID: 25309345] (IF/IHC, Rat)
• Hitti FL, Siegelbaum SA. The hippocampal CA2 region is essential for social memory. Nature 2014-04-03 [PMID: 24572357]
• Kohara K, Pignatelli M, Rivest AJ et al. Cell type-specific genetic and optogenetic tools reveal hippocampal CA2 circuits. Nat Neurosci 2014-02-01 [PMID: 24336151]
• Souali-Crespo S, Condrea D, Vernet N et al. Loss of NR5A1 in Sertoli cells after sex determination changes their cellular identity and induces their death by anoikis bioRxiv 2023-01-07
• Martikainen M, Lugano R, Pietilä I et al. VLDLR mediates alphavirus neuroinvasion through the blood-cerebrospinal fluid barrier Research Square 2023-10-30
• Ben-Simon Y, Kaefer K, Velicky P et al. A direct excitatory projection from entorhinal layer 6b neurons to the hippocampus contributes to spatial coding and memory Nature communications 2022-08-16 [PMID: 35974109] (IF/IHC, Mouse)
  
  Details:
  Supplementary Figure 5: Dilutions: 1:500

Bioinformatics

• Gene Symbol: PCP4
• Entrez:
  • 5121(Human)
• Uniprot:
  • P48539(Human)