PCP4 Antibody - BSA Free

Staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Staining of mouse cerebral cortex shows strong positivity in the deep layers neurons.

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity.

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCP4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PCP4 Protein (NBP1-80929PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26214372).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCP4 Antibody - BSA Free

• brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4
• Brain-specific polypeptide PEP-19
• PEP19
• PEP-19
• Purkinje cell protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCP4 Antibody (NBP1-80929)(8)

Publications using NBP1-80929

• Manuel Valero, Elena Cid, Robert G Averkin et al. Determinants of different deep and superficial CA1 pyramidal cell dynamics during sharp-wave ripples. Nature Neuroscience 2015-07-27 [PMID: 26214372] (IF/IHC, Rat)
• Zhou J, Shaikh LH, Neogi SG et al. DACH1, a Zona Glomerulosa Selective Gene in the Human Adrenal, Activates Transforming Growth Factor--beta Signaling and Suppresses Aldosterone Secretion. Hypertension 2015-05-01 [PMID: 25776071] (IF/IHC, Human)
• Botcher NA, Falck JE, Thomson AM, Mercer A. Distribution of interneurons in the CA2 region of the rat hippocampus. Front Neuroanat 2014-01-01 [PMID: 25309345] (IF/IHC, Rat)
• Hitti FL, Siegelbaum SA. The hippocampal CA2 region is essential for social memory. Nature 2014-04-03 [PMID: 24572357]
• Kohara K, Pignatelli M, Rivest AJ et al. Cell type-specific genetic and optogenetic tools reveal hippocampal CA2 circuits. Nat Neurosci 2014-02-01 [PMID: 24336151]
• Souali-Crespo S, Condrea D, Vernet N et al. Loss of NR5A1 in Sertoli cells after sex determination changes their cellular identity and induces their death by anoikis bioRxiv 2023-01-07
• Martikainen M, Lugano R, Pietilä I et al. VLDLR mediates alphavirus neuroinvasion through the blood-cerebrospinal fluid barrier Research Square 2023-10-30
• Ben-Simon Y, Kaefer K, Velicky P et al. A direct excitatory projection from entorhinal layer 6b neurons to the hippocampus contributes to spatial coding and memory Nature communications 2022-08-16 [PMID: 35974109] (IF/IHC, Mouse)
  
  Details:
  Supplementary Figure 5: Dilutions: 1:500

Bioinformatics

• Gene Symbol: PCP4
• Entrez:
  • 5121(Human)
• Uniprot:
  • P48539(Human)