PCP4 Antibody

Images

 
Western Blot: PCP4 Antibody [NBP1-80929] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: PCP4 Antibody [NBP1-80929] - Immunofluorescence staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Staining in human cerebral cortex and liver tissues. Corresponding PCP4 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: PCP4 Antibody [NBP1-80929] - Immunofluorescence staining of mouse cerebral cortex shows strong positivity in the deep layers neurons.
Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Staining of human cerebral cortex shows moderate cytoplasmic positivity.
Immunohistochemistry-Paraffin: PCP4 Antibody [NBP1-80929] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PCP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Specificity
Specificity of human, mouse PCP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCP4 Protein (NBP1-80929PEP)
Publications
Read Publications using
NBP1-80929 in the following applications:

  • IHC
    3 publications

Reactivity Notes

Mouse Reactivity reported in scientific literature (PMID: 24336151).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCP4 Antibody

  • brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4
  • Brain-specific polypeptide PEP-19
  • PEP19
  • PEP-19
  • Purkinje cell protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
MAB7947
Species: Hu, Mu, Rt
Applications: IHC
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
NB300-143
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IF
NBP1-84011
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-82826
Species: Hu
Applications: IHC, IHC-P

Publications for PCP4 Antibody (NBP1-80929)(5)

Reviews for PCP4 Antibody (NBP1-80929) (0)

There are no reviews for PCP4 Antibody (NBP1-80929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCP4 Antibody (NBP1-80929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PCP4 Antibody (NBP1-80929)

Discover related pathways, diseases and genes to PCP4 Antibody (NBP1-80929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCP4 Antibody (NBP1-80929)

Discover more about diseases related to PCP4 Antibody (NBP1-80929).
 

Pathways for PCP4 Antibody (NBP1-80929)

View related products by pathway.

PTMs for PCP4 Antibody (NBP1-80929)

Learn more about PTMs related to PCP4 Antibody (NBP1-80929).

Blogs on PCP4

There are no specific blogs for PCP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCP4
Entrez
Uniprot