ATP6V0A1 Antibody

Western Blot: ATP6V0A1 Antibody [H00000535-A01] - Detection against Immunogen (35.68 KDa)

Product Discontinued

ATP6V0A1 Antibody Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATP6V0A1 (NP_005168, 212 a.a. - 298 a.a.) partial recombinant protein with GST tag. GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR
• Specificity: ATP6V0A1 - ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ATP6V0A1
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50 % glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0A1 Antibody

• a1
• ATP6N1
• ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
• ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
• ATPase, H+ transporting, lysosomal V0 subunit a1
• Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
• DKFZp781J1951
• Stv1
• Vacuolar adenosine triphosphatase subunit Ac116
• Vacuolar proton pump subunit 1
• vacuolar proton pump, subunit 1
• Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
• vacuolar proton translocating ATPase 116 kDa subunit A
• vacuolar-type H(+)-ATPase 115 kDa subunit
• V-ATPase 116 kDa isoform a1
• V-ATPase 116 kDa
• Vph1
• VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
• V-type proton ATPase 116 kDa subunit a isoform 1
• V-type proton ATPase 116 kDa subunit a

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. The occurrence of splice variants encoding different protein products has been reported, but the full-length natures of these transcripts have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0A1 Antibody (H00000535-A01)(3)

Publications using H00000535-A01

• Liang Y, Zheng D, Peng S et al. Rifampicin attenuates rotenone-treated microglia inflammation via improving lysosomal function. Toxicol In Vitro. 2019-10-22 [PMID: 31648047]
• Appu A, Bagh M, Sadhukhan T et al. Cln3-mutations underlying juvenile NCL cause significantly reduced levels of Ppt1-protein and Ppt1-enzyme activity in the lysosome. J Inherit Metab Dis. 2019-04-26 [PMID: 31025705]
• Chasiotis H, Ionescu A, Misyura L et al. An animal homolog of plant Mep/Amt transporters promotes ammonia excretion by the anal papillae of the disease vector mosquito, Aedes aegypti. J Exp Biol 2016-05-01 [PMID: 26944496]

Bioinformatics

• Gene Symbol: ATP6V0A1
• Entrez:
  • 535(Human)
• OMIM:
  • 192130(Human)
• Uniprot:
  • NP_005168(Human)