ATP5O Antibody

Images

 
Western Blot: ATP5O Antibody [NBP2-32602] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry: ATP5O Antibody [NBP2-32602] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP5O Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5O
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP5O Protein (NBP2-32602PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP5O Antibody

  • ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
  • human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial
  • Oligomycin sensitivity conferral protein
  • oligomycin sensitivity conferring protein
  • OSCPhuman ATP synthase OSCP subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90069
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-88935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2564
Species: Hu
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ATP5O Antibody (NBP2-32602) (0)

There are no publications for ATP5O Antibody (NBP2-32602).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5O Antibody (NBP2-32602) (0)

There are no reviews for ATP5O Antibody (NBP2-32602). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5O Antibody (NBP2-32602) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5O Products

Bioinformatics Tool for ATP5O Antibody (NBP2-32602)

Discover related pathways, diseases and genes to ATP5O Antibody (NBP2-32602). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5O Antibody (NBP2-32602)

Discover more about diseases related to ATP5O Antibody (NBP2-32602).
 

Pathways for ATP5O Antibody (NBP2-32602)

View related products by pathway.

PTMs for ATP5O Antibody (NBP2-32602)

Learn more about PTMs related to ATP5O Antibody (NBP2-32602).
 

Research Areas for ATP5O Antibody (NBP2-32602)

Find related products by research area.

Blogs on ATP5O

There are no specific blogs for ATP5O, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5O Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5O