ATP5F1 Antibody - BSA Free

Western Blot: ATP5F1 Antibody [NBP1-54702] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml ATP5F1 is supported by BioGPS gene expression data to be expressed in MCF7

Western Blot: ATP5F1 Antibody [NBP1-54702] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP5F1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP5F1(ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1) The peptide sequence was selected from the middle region of ATP5F1. Peptide sequence VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: b, mitochondrial.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5PB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP5F1 Antibody - BSA Free

• ATP synthase B chain, mitochondrial
• ATP synthase subunit b, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
• ATPase subunit b
• cell proliferation-inducing protein 47
• H+-ATP synthase subunit b
• MGC24431
• PIG47

Background

ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5PB
• Uniprot:
  • P24539(Human)