Atlastin-2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] - Immunofluorescence analysis of HeLa cells using Atlastin-2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] - Immunofluorescence analysis of C6 cells using Atlastin-2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: Atlastin-2 Antibody [NBP3-35616] - Western blot analysis of lysates from HepG2 cells, using Atlastin-2 Rabbit pAb at 1:800 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] - Immunofluorescence analysis of L929 cells using Atlastin-2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Atlastin-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Atlastin-2 Antibody - BSA Free (NBP3-35616) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human Atlastin-2 (NP_001129145.1).
  
  Sequence:
  ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 66 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Atlastin-2 Antibody - BSA Free

• ADP-ribosylation factor-like 6 interacting protein 2
• ADP-ribosylation factor-like protein 6-interacting protein 2
• ADP-ribosylation-like factor 6 interacting protein 2
• aip-2
• ARL3IP2
• ARL-6-interacting protein 2
• ARL6IP2
• atlastin GTPase 2
• atlastin2
• atlastin-2
• EC 3.6.5.-
• FLJ23293

Background

GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion ofendoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATL2