Atlastin-2 Antibody

Images

 
Immunohistochemistry: Atlastin-2 Antibody [NBP1-90102] - Staining of human duodenum shows distinct cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Atlastin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Atlastin-2 Protein (NBP1-90102PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Atlastin-2 Antibody

  • ADP-ribosylation factor-like 6 interacting protein 2
  • ADP-ribosylation factor-like protein 6-interacting protein 2
  • ADP-ribosylation-like factor 6 interacting protein 2
  • aip-2
  • ARL3IP2
  • ARL-6-interacting protein 2
  • ARL6IP2
  • atlastin GTPase 2
  • atlastin2
  • atlastin-2
  • EC 3.6.5.-
  • FLJ23293

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-90202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49637
Species: Hu
Applications: WB, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for Atlastin-2 Antibody (NBP1-90102) (0)

There are no publications for Atlastin-2 Antibody (NBP1-90102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Atlastin-2 Antibody (NBP1-90102) (0)

There are no reviews for Atlastin-2 Antibody (NBP1-90102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Atlastin-2 Antibody (NBP1-90102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Atlastin-2 Products

Bioinformatics Tool for Atlastin-2 Antibody (NBP1-90102)

Discover related pathways, diseases and genes to Atlastin-2 Antibody (NBP1-90102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Atlastin-2 Antibody (NBP1-90102)

Discover more about diseases related to Atlastin-2 Antibody (NBP1-90102).
 

Pathways for Atlastin-2 Antibody (NBP1-90102)

View related products by pathway.

PTMs for Atlastin-2 Antibody (NBP1-90102)

Learn more about PTMs related to Atlastin-2 Antibody (NBP1-90102).

Blogs on Atlastin-2

There are no specific blogs for Atlastin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Atlastin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATL2