Recombinant Human ATIC GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ATIC Protein [H00000471-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ATIC GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 592 of Human ATIC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ATIC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATIC GST (N-Term) Protein

  • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMPcyclohydrolase
  • 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotidetransformylase/inosinicase
  • AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme
  • AICAR
  • AICARFT
  • AICARFT/IMPCHASE
  • bifunctional purine biosynthesis protein PURH
  • IMPCHASE
  • phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  • PURHFLJ93545

Background

ATIC is a 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase which helps catalyze the penultimate and final steps of the de novo purine biosynthetic pathway. The human ATIC cDNA encodes a deduced 591 amino acid protein that is 81% identical to the chicken sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
H00005564-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
210-TA
Species: Hu
Applications: BA
NBP2-74462
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
DRP300
Species: Hu
Applications: ELISA
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
H00000471-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ATIC Recombinant Protein (H00000471-P01) (0)

There are no publications for ATIC Recombinant Protein (H00000471-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATIC Recombinant Protein (H00000471-P01) (0)

There are no reviews for ATIC Recombinant Protein (H00000471-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATIC Recombinant Protein (H00000471-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATIC Products

Bioinformatics Tool for ATIC Recombinant Protein (H00000471-P01)

Discover related pathways, diseases and genes to ATIC Recombinant Protein (H00000471-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATIC Recombinant Protein (H00000471-P01)

Discover more about diseases related to ATIC Recombinant Protein (H00000471-P01).
 

Pathways for ATIC Recombinant Protein (H00000471-P01)

View related products by pathway.

PTMs for ATIC Recombinant Protein (H00000471-P01)

Learn more about PTMs related to ATIC Recombinant Protein (H00000471-P01).
 

Research Areas for ATIC Recombinant Protein (H00000471-P01)

Find related products by research area.

Blogs on ATIC

There are no specific blogs for ATIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATIC GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATIC