ATG9A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATG9A Antibody [NBP2-32477] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: ATG9A Antibody [NBP2-32477] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG9A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG9A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATG9A Protein (NBP2-32477PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG9A Antibody

  • APG9 autophagy 9-like 1 (S. cerevisiae)
  • APG9 autophagy 9-like 1
  • APG9L1APG9-like 1
  • ATG9 autophagy related 9 homolog A (S. cerevisiae)
  • autophagy 9-like 1 protein
  • autophagy-related protein 9A
  • FLJ22169
  • mATG9
  • MGD3208

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-77169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20950
Species: Hu
Applications: WB, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP2-24683
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ICC, IF
NB100-77279
Species: Hu, Mu
Applications: WB, IP
NBP2-32477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ATG9A Antibody (NBP2-32477) (0)

There are no publications for ATG9A Antibody (NBP2-32477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG9A Antibody (NBP2-32477) (0)

There are no reviews for ATG9A Antibody (NBP2-32477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATG9A Antibody (NBP2-32477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG9A Products

Bioinformatics Tool for ATG9A Antibody (NBP2-32477)

Discover related pathways, diseases and genes to ATG9A Antibody (NBP2-32477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG9A Antibody (NBP2-32477)

Discover more about diseases related to ATG9A Antibody (NBP2-32477).
 

Pathways for ATG9A Antibody (NBP2-32477)

View related products by pathway.

PTMs for ATG9A Antibody (NBP2-32477)

Learn more about PTMs related to ATG9A Antibody (NBP2-32477).
 

Research Areas for ATG9A Antibody (NBP2-32477)

Find related products by research area.

Blogs on ATG9A.

Atg9b - a marker for autophagosome induction and assembly
Atg9 is the only essential transmembrane protein involved in cellular autophagy. Autophagy regulates cellular homeostasis by allowing the turnover and recycling of misfolded proteins and damaged organelles. Formation of the double-membrane isolatio...  Read full blog post.

ATG9A - early marker autophagosome assembly
ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG9A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG9A