ATG9A Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: ATG9A Antibody [NBP2-32477] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: ATG9A Antibody [NBP2-32477] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ATG9A Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ATG9A Antibody - BSA Free (NBP2-32477) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG9A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATG9A Protein (NBP2-32477PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ATG9A Antibody - BSA Free

  • APG9 autophagy 9-like 1 (S. cerevisiae)
  • APG9 autophagy 9-like 1
  • APG9L1APG9-like 1
  • ATG9 autophagy related 9 homolog A (S. cerevisiae)
  • autophagy 9-like 1 protein
  • autophagy-related protein 9A
  • FLJ22169
  • mATG9
  • MGD3208

Background

Survival of environmental stress conditions requires the maintenance of cellular homeostasis. To preserve this balance, cells utilize a degradative mechanism known as autophagy. During this process, in response to starvation or other stresses, bulk cytoplasm is non-specifically sequestered within double-membrane vesicles and delivered to the lysosome/vacuole for subsequent degradation and recycling. Atg9 is the only integral membrane protein required for autophagosome formation and is considered a membrane carrier in autophagy-related pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-77169
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NBP1-88879
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-60928
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC,  IHC-P, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-84267
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NB100-77279
Species: Hu, Mu
Applications: IP, WB

Publications for ATG9A Antibody (NBP2-32477) (0)

There are no publications for ATG9A Antibody (NBP2-32477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG9A Antibody (NBP2-32477) (0)

There are no reviews for ATG9A Antibody (NBP2-32477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATG9A Antibody (NBP2-32477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG9A Products

Research Areas for ATG9A Antibody (NBP2-32477)

Find related products by research area.

Blogs on ATG9A.

Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis
By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit...  Read full blog post.

Mechanisms of Neurodegeneration: Protein aggregation and failure of autophagy
By Michalina Hanzel, PhDIn a series of three blog posts I will briefly explore the major cellular mechanisms responsible for many neurodegenerative disorders. The first, and perhaps the most apparent, is the accumulat...  Read full blog post.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

Atg9b - a marker for autophagosome induction and assembly
Atg9 is the only essential transmembrane protein involved in cellular autophagy. Autophagy regulates cellular homeostasis by allowing the turnover and recycling of misfolded proteins and damaged organelles. Formation of the double-membrane isolatio...  Read full blog post.

ATG9A - early marker autophagosome assembly
ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG9A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG9A