ATG7 Recombinant Protein Antigen

Images

 
There are currently no images for ATG7 Protein (NBP1-89042PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATG7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG7.

Source: E.coli

Amino Acid Sequence: EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATG7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89042.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ATG7 Recombinant Protein Antigen

  • APG7 autophagy 7-like (S. cerevisiae)
  • APG7
  • APG7L
  • APG7-LIKE
  • ATG12-activating enzyme E1 ATG7
  • ATG7 autophagy related 7 homolog (S. cerevisiae)
  • ATG7
  • Autophagy-related protein 7
  • DKFZp434N0735
  • GSA7
  • hAGP7
  • ubiquitin activating enzyme E1-like protein
  • Ubiquitin-activating enzyme E1-like protein
  • ubiquitin-like modifier-activating enzyme ATG7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA, RIA
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-89042PEP
Species: Hu
Applications: AC

Publications for ATG7 Protein (NBP1-89042PEP) (0)

There are no publications for ATG7 Protein (NBP1-89042PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG7 Protein (NBP1-89042PEP) (0)

There are no reviews for ATG7 Protein (NBP1-89042PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ATG7 Protein (NBP1-89042PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ATG7 Protein (NBP1-89042PEP)

Discover related pathways, diseases and genes to ATG7 Protein (NBP1-89042PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG7 Protein (NBP1-89042PEP)

Discover more about diseases related to ATG7 Protein (NBP1-89042PEP).
 

Pathways for ATG7 Protein (NBP1-89042PEP)

View related products by pathway.

PTMs for ATG7 Protein (NBP1-89042PEP)

Learn more about PTMs related to ATG7 Protein (NBP1-89042PEP).
 

Research Areas for ATG7 Protein (NBP1-89042PEP)

Find related products by research area.

Blogs on ATG7.

Monitoring Autophagy in Neurons
By Christina Towers, PhD. Autophagy is a critical cellular process used by most cells in the body to recycle nutrients and prevent harmful buildup of damaged proteins. It is particularly important in the brain, where...  Read full blog post.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

Nuclear LC3: Why is it there and what is it doing?
By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.  There are over 20 proteins that have been implicated in this process and appropriately named core...  Read full blog post.

From Then ‘till Now: The History of Autophagy and Cancer Research
By Christina Towers, PhD. The fundamental process that cells use to degrade damaged cytoplasmic material and recycle nutrients is called autophagy.  This term was first coined by the Belgium biochemist Christian de...  Read full blog post.

ATG4B - a cysteine protease involved in autophagosome elongation
Autophagy can be broken down into 4 main stages: phagophore nucleation, autophagosome elongation, autophagosome docking and fusion with a lysosome, and vesicle breakdown and degradation. ATG4B is one of four ATG4 homologs (ATG4A, ATG4B, ATG4C, and...  Read full blog post.

ATG7 - an E1 enzyme for the ubiquitin-like autophagy proteins
Autophagy is an essential cellular process that maintains homeostasis through the degradation and recycling of cytoplasmic organelles and macromolecules. Substrates targeted for autophagy are engulfed in a double-membrane structure called the auto...  Read full blog post.

ATG12 - a ubiquitin-like protein essential for autophagosome assembly
Atg12 is a ubiquitin-like protein that plays an essential role in cellular homeostasis by regulating the degradation and recycling of cytoplasmic organelles and macromolecules. Atg12 is one of two ubiquitin-like protein systems that is required du...  Read full blog post.

Essential to Death: ATG5 (autophagy protein 5, apoptosis-specific protein ASP)
The ATG5 protein belongs to the ATG autophagy regulator family. This family controls the highly conserved cell's homeostatic response to a wide variety of both self- and foreign-originating cellular stimuli. ATG5 itself is ubiquitously expressed in mo...  Read full blog post.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATG7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG7
Entrez