ATG4B Antibody


Western Blot: ATG4B Antibody [NBP2-57210] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: ATG4B Antibody [NBP2-57210] - Staining of human cell line RT4 shows localization to nucleoplasm & cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

ATG4B Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATG4B Recombinant Protein Antigen (NBP2-57210PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ATG4B Antibody

  • APG4 autophagy 4 homolog B (S. cerevisiae)
  • APG4 autophagy 4 homolog B
  • Apg4B
  • ATG4 autophagy related 4 homolog B (S. cerevisiae)
  • ATG4B
  • AUTL1
  • AUTL1MGC1353
  • AUT-like 1 cysteine endopeptidase
  • autophagin-1
  • Autophagy-related cysteine endopeptidase 1
  • Autophagy-related protein 4 homolog B
  • cysteine protease ATG4B
  • DKFZp586D1822
  • EC 3.4.22
  • EC 3.4.22.-
  • hAPG4B
  • KIAA0943


FUNCTION: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ENZYME REGULATION: Inhibited by N-ethylmaleimide. SUBCELLULAR LOCATION: Cytoplasm (Probable). ALTERNATIVE PRODUCTS: 5 named isoforms produced by alternative splicing.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATG4B Antibody (NBP2-57210) (0)

There are no publications for ATG4B Antibody (NBP2-57210).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4B Antibody (NBP2-57210) (0)

There are no reviews for ATG4B Antibody (NBP2-57210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATG4B Antibody (NBP2-57210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATG4B Products

Research Areas for ATG4B Antibody (NBP2-57210)

Find related products by research area.

Blogs on ATG4B.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

  Read full blog post.

ATG4B - a cysteine protease involved in autophagosome elongation
Autophagy can be broken down into 4 main stages: phagophore nucleation, autophagosome elongation, autophagosome docking and fusion with a lysosome, and vesicle breakdown and degradation. ATG4B is one of four ATG4 homologs (ATG4A, ATG4B, ATG4C, and ...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATG4B Antibody and receive a gift card or discount.


Gene Symbol ATG4B