ATG16L1 Recombinant Protein Antigen

Images

 
There are currently no images for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATG16L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG16L1.

Source: E. coli

Amino Acid Sequence: LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATG16L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49408.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATG16L1 Recombinant Protein Antigen

  • APG16 autophagy 16-like (S. cerevisiae)
  • APG16L beta
  • APG16LFLJ10828
  • APG16-like 1
  • ATG16 autophagy related 16-like (S. cerevisiae)
  • ATG16 autophagy related 16-like 1 (S. cerevisiae)
  • ATG16A
  • ATG16L
  • autophagy-related protein 16-1
  • FLJ00045
  • FLJ10035
  • FLJ22677
  • IBD10
  • WD repeat domain 30
  • WDR30

Background

Macroautophagy is the major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane bound autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane bound structure, which then fuse with the lysosome (or vacuole) releasing a single-membrane bound autophagic bodies which are then degraded within the lysosome (or vacuole). The APG12-APG5-APG16L complex is essential for the elongation of autophagic isolation membranes. This complex initially associates in uniform distribution with small vesicle membranes. During membrane elongation, the complex partitions, with a great concentration building on the outer side of the isolation membrane. Upon completion of the formation of the autophagosome, the APG12-APG5-APG16L dissociates from the membrane. There are 5 isoforms of this protein (in human), with theoretical molecular weights ranging from ~19-68 kDa.

Mutations in the ATG16L1 proitein have been associated with Crohn's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1686
Species: Mu
Applications: Neut, WB
NBP1-76377
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-94796
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00006583-A01
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB7442
Species: Hu
Applications: B/N, WB
NBP2-47559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-85385
Species: Hu, Mu
Applications: WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49408PEP
Species: Hu
Applications: AC

Publications for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP) (0)

There are no publications for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP) (0)

There are no reviews for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG16L1 Products

Research Areas for ATG16L1 Recombinant Protein Antigen (NBP2-49408PEP)

Find related products by research area.

Blogs on ATG16L1.

Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis
By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit...  Read full blog post.

ATG16L1 - a key player in the development of the autophagosome
Like apoptosis, autophagy is a highly regulated physiologic process that involves cellular degradation and recycling of organelles and macromolecules. Autophagy is a survival mechanism induced by states of stress, starvation, and infection. A do...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATG16L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG16L1