ATG12 Recombinant Protein Antigen

Images

 
There are currently no images for ATG12 Recombinant Protein Antigen (NBP3-25289PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATG12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG12

Source: E.coli

Amino Acid Sequence: SEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATG12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25289It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATG12 Recombinant Protein Antigen

  • Apg12 (autophagy 12, S. cerevisiae)-like
  • APG12 autophagy 12-like (S. cerevisiae)
  • APG12
  • APG12HAPG12
  • APG12-like
  • ATG12 autophagy related 12 homolog (S. cerevisiae)
  • ATG12
  • Autophagy-related protein 12
  • FBR93
  • HAPG12
  • ubiquitin-like protein ATG12
  • yeast) homolog

Background

The ATG12 gene codes a ubiquitin-like protein ATG12 that in isoform 1 is 140 amino acids long at 15 kDA and in isoform 2 is 74 amino acids long at 7 kDA. This protein is critical for autophagy (bulk protein degradation) as it is the human homolog of a yeast protein that participates in autophagy. ATG12 participates in the immune system, apoptosis and autophagy, protein stability, negative regulators of RIG-I/MDA5 signaling, and glucose/energy metabolism. It is known to interact with various genes such as HIST1H2BF, HIST1H2BE, HIST1H2BI, HIST1H2BG, and HIST1H2BC. ATG12 has been researched regarding its role in leukemia, lung cancer, myositis, retinitis, carcinoma, colorectal cancer, and myelodysplastic syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP1-55202
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP2-24594
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01083
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-60928
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-25289PEP
Species: Hu
Applications: AC

Publications for ATG12 Recombinant Protein Antigen (NBP3-25289PEP) (0)

There are no publications for ATG12 Recombinant Protein Antigen (NBP3-25289PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG12 Recombinant Protein Antigen (NBP3-25289PEP) (0)

There are no reviews for ATG12 Recombinant Protein Antigen (NBP3-25289PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATG12 Recombinant Protein Antigen (NBP3-25289PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG12 Products

Research Areas for ATG12 Recombinant Protein Antigen (NBP3-25289PEP)

Find related products by research area.

Blogs on ATG12. Showing 1-10 of 16 blog posts - Show all blog posts.

Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis
By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit...  Read full blog post.


  Read full blog post.


  Read full blog post.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

WIPI1 - An essential regulator of early autophagosome assembly
WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ...  Read full blog post.

ATG4C - A regulator of the early steps of autophagosome assembly
Autophagy is an important cellular process that maintains homeostasis by degrading and recycling damaged proteins and organelles. Autophagy receptors, such as p62/SQSTM1, recognize these intracellular cargo and mediate their engulfment by the doubl...  Read full blog post.

ATG16L2 - An autophagy-related protein with unknown functions
Autophagy is a process by which cells degrade and recycle damaged organelles or misfolded proteins. These various cargo are engulfed in a double-membrane structure called the autophagosome. The autophagosome then fuses with the lysosome to facilit...  Read full blog post.

ATG4D - A regulator of autophagy and apoptosis
Autophagy is an essential cellular process whereby damaged proteins and organelles are degraded and recycled. Autophagy, while happening constantly at a basal level, is tightly regulated and can be further induced under cellular stress. One of the ...  Read full blog post.

ATG4B - a cysteine protease involved in autophagosome elongation
Autophagy can be broken down into 4 main stages: phagophore nucleation, autophagosome elongation, autophagosome docking and fusion with a lysosome, and vesicle breakdown and degradation. ATG4B is one of four ATG4 homologs (ATG4A, ATG4B, ATG4C, and ...  Read full blog post.

Showing 1-10 of 16 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATG12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG12