ATF4 Antibody (2E3)

Images

 
ELISA: ATF4 Antibody (2E3) [H00000468-M07] - Detection limit for recombinant GST tagged ATF4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATF4 Antibody (2E3) Summary

Immunogen
ATF4 (AAH08090, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPPPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Specificity
ATF4 - activating transcription factor 4 (tax-responsive enhancer element B67) (2E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.
Publications
Read Publication using H00000468-M07.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATF4 Antibody (2E3)

  • activating transcription factor 4 (tax-responsive enhancer element B67)
  • Activating transcription factor 4
  • ATF4
  • cAMP-dependent transcription factor ATF-4
  • cAMP-responsive element-binding protein 2
  • CREB-2DNA-binding protein TAXREB67
  • cyclic AMP-dependent transcription factor ATF-4
  • Cyclic AMP-responsive element-binding protein 2
  • TAXREB67
  • TAXREB67CREB2cAMP response element-binding protein 2
  • Tax-responsive enhancer element-binding protein 67
  • TXREB

Background

This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-80930
Species: Ch, Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
212-GD/CF
Species: Hu
Applications: Bind, BA
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
1310-SE
Species: Hu
Applications: EnzAct
NBP1-85816
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP2-66865
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-778
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2323
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-56398
Species: Hu
Applications: ICC/IF, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for ATF4 Antibody (H00000468-M07)(1)

Reviews for ATF4 Antibody (H00000468-M07) (0)

There are no reviews for ATF4 Antibody (H00000468-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF4 Antibody (H00000468-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF4 Products

Bioinformatics Tool for ATF4 Antibody (H00000468-M07)

Discover related pathways, diseases and genes to ATF4 Antibody (H00000468-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF4 Antibody (H00000468-M07)

Discover more about diseases related to ATF4 Antibody (H00000468-M07).
 

Pathways for ATF4 Antibody (H00000468-M07)

View related products by pathway.

PTMs for ATF4 Antibody (H00000468-M07)

Learn more about PTMs related to ATF4 Antibody (H00000468-M07).
 

Research Areas for ATF4 Antibody (H00000468-M07)

Find related products by research area.

Blogs on ATF4.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF4 Antibody (2E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF4
Entrez
Uniprot