ATE1 Antibody

Images

 
Western Blot: ATE1 Antibody [NBP1-85872] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ATE1 Antibody [NBP1-85872] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: ATE1 Antibody [NBP1-85872] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATE1 Protein (NBP1-85872PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATE1 Antibody

  • Arginine-tRNA--protein transferase 1
  • arginyltransferase 1MGC26724
  • arginyl-tRNA--protein transferase 1
  • arginyl-tRNA-protein transferase
  • EC 2.3.2.8
  • R-transferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF3026
Species: Mu
Applications: WB
NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB666
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-91868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATE1 Antibody (NBP1-85872) (0)

There are no publications for ATE1 Antibody (NBP1-85872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATE1 Antibody (NBP1-85872) (0)

There are no reviews for ATE1 Antibody (NBP1-85872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATE1 Antibody (NBP1-85872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATE1 Products

Bioinformatics Tool for ATE1 Antibody (NBP1-85872)

Discover related pathways, diseases and genes to ATE1 Antibody (NBP1-85872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATE1 Antibody (NBP1-85872)

Discover more about diseases related to ATE1 Antibody (NBP1-85872).
 

Pathways for ATE1 Antibody (NBP1-85872)

View related products by pathway.

PTMs for ATE1 Antibody (NBP1-85872)

Learn more about PTMs related to ATE1 Antibody (NBP1-85872).

Blogs on ATE1

There are no specific blogs for ATE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATE1