ATAD3A Antibody - BSA Free

Western Blot: ATAD3A Antibody [NBP2-55766] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: ATAD3A Antibody [NBP2-55766] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATAD3A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRR
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATAD3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATAD3A Recombinant Protein Antigen (NBP2-55766PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATAD3A Antibody - BSA Free

• ATPase family AAA domain-containing protein 3A
• ATPase family, AAA domain containing 3A
• FLJ10709
• FLJ35514

Background

ATAD3A and ATAD3B (MIM 612317) are mitochondrial membrane proteins that contribute to the stabilization of large mitochondrial DNA (mtDNA)-protein complexes called nucleoids (He et al., 2007 [PubMed 17210950]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATAD3A