Aspartyl Aminopeptidase Antibody Summary
Immunogen |
DNPEP (AAH03040.1, 1 a.a. - 164 a.a.) full-length human protein. MTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGLSMLWMSGTIRSSCPCSVPIWG |
Specificity |
DNPEP - aspartyl aminopeptidase, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DNPEP |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Aspartyl Aminopeptidase Antibody
Background
The protein encoded by this gene is an aminopeptidase which prefers acidic amino acids, and specifically favors aspartic acid over glutamic acid. It is thought to be a cytosolic protein involved in general metabolism of intracellular proteins. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IHC-P, IP
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Publications for Aspartyl Aminopeptidase Antibody (H00023549-D01P) (0)
There are no publications for Aspartyl Aminopeptidase Antibody (H00023549-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aspartyl Aminopeptidase Antibody (H00023549-D01P) (0)
There are no reviews for Aspartyl Aminopeptidase Antibody (H00023549-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aspartyl Aminopeptidase Antibody (H00023549-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Aspartyl Aminopeptidase Products
Bioinformatics Tool for Aspartyl Aminopeptidase Antibody (H00023549-D01P)
Discover related pathways, diseases and genes to Aspartyl Aminopeptidase Antibody (H00023549-D01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Aspartyl Aminopeptidase Antibody (H00023549-D01P)
Discover more about diseases related to Aspartyl Aminopeptidase Antibody (H00023549-D01P).
| | Pathways for Aspartyl Aminopeptidase Antibody (H00023549-D01P)
View related products by pathway.
|
Research Areas for Aspartyl Aminopeptidase Antibody (H00023549-D01P)
Find related products by research area.
|
Blogs on Aspartyl Aminopeptidase