ASNSD1 Antibody

Images

 
Western Blot: ASNSD1 Antibody [NBP1-83634] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: ASNSD1 Antibody [NBP1-83634] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASNSD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NQWQEVPASGLFRIDLKSTVISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKPVVPLNMMLPQAALETHCSNISNVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASNSD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASNSD1 Protein (NBP1-83634PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASNSD1 Antibody

  • asparagine synthetase domain containing 1
  • asparagine synthetase domain-containing protein 1
  • HCV NS3-transactivated protein 1
  • NBLA00058
  • NS3TP1FLJ20752

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP2-02673
Species: Hu, Ca
Applications: WB, Flow, IHC, IHC-P
NBP2-55525
Species: Hu
Applications: ICC/IF
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3025
Species: Hu
Applications: WB, ICC
NBP1-93912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56777
Species: Hu
Applications: ICC/IF
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-76577
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14407
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82296
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P

Publications for ASNSD1 Antibody (NBP1-83634) (0)

There are no publications for ASNSD1 Antibody (NBP1-83634).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASNSD1 Antibody (NBP1-83634) (0)

There are no reviews for ASNSD1 Antibody (NBP1-83634). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASNSD1 Antibody (NBP1-83634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASNSD1 Products

Bioinformatics Tool for ASNSD1 Antibody (NBP1-83634)

Discover related pathways, diseases and genes to ASNSD1 Antibody (NBP1-83634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASNSD1 Antibody (NBP1-83634)

Discover more about diseases related to ASNSD1 Antibody (NBP1-83634).
 

Pathways for ASNSD1 Antibody (NBP1-83634)

View related products by pathway.

Research Areas for ASNSD1 Antibody (NBP1-83634)

Find related products by research area.

Blogs on ASNSD1

There are no specific blogs for ASNSD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASNSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASNSD1