ASCL1/Mash1 Antibody (2D9) Summary
Immunogen |
ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF |
Specificity |
ASCL1 - achaete-scute complex-like 1 (Drosophila) |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ASCL1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ASCL1/Mash1 Antibody (2D9)
Background
This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Mu, Rt
Applications: WB, IHC, ChIP, ICC
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Species: Hu, Mu
Applications: ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Publications for ASCL1/Mash1 Antibody (H00000429-M02)(1)
Showing Publication 1 -
1 of 1.
Reviews for ASCL1/Mash1 Antibody (H00000429-M02) (0)
There are no reviews for ASCL1/Mash1 Antibody (H00000429-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ASCL1/Mash1 Antibody (H00000429-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional ASCL1/Mash1 Products
Bioinformatics Tool for ASCL1/Mash1 Antibody (H00000429-M02)
Discover related pathways, diseases and genes to ASCL1/Mash1 Antibody (H00000429-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ASCL1/Mash1 Antibody (H00000429-M02)
Discover more about diseases related to ASCL1/Mash1 Antibody (H00000429-M02).
| | Pathways for ASCL1/Mash1 Antibody (H00000429-M02)
View related products by pathway.
|
PTMs for ASCL1/Mash1 Antibody (H00000429-M02)
Learn more about PTMs related to ASCL1/Mash1 Antibody (H00000429-M02).
| | Research Areas for ASCL1/Mash1 Antibody (H00000429-M02)
Find related products by research area.
|
Blogs on ASCL1/Mash1