Home » ASCL1/Mash1 » ASCL1/Mash1 Antibodies » ASCL1/Mash1 Antibody (2D9)

ASCL1/Mash1 Antibody (2D9)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ASCL1/Mash1 Antibody (2D9) [H00000429-M02] - Analysis of monoclonal antibody to ASCL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: ASCL1/Mash1 Antibody (2D9) [H00000429-M02] - Analysis of monoclonal antibody to ASCL1 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASCL1/Mash1 Antibody (2D9) Summary

Immunogen
ASCL1 (NP_004307, 137 a.a. - 236 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Specificity
ASCL1 - achaete-scute complex-like 1 (Drosophila)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASCL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASCL1/Mash1 Antibody (2D9)

  • achaete-scute complex (Drosophila) homolog-like 1
  • achaete-scute complex homolog 1 (Drosophila)
  • achaete-scute complex-like 1 (Drosophila)
  • achaete-scute homolog 1
  • ASCL1
  • ASH1
  • ASH-1
  • ASH1MASH1
  • BHLHA46
  • bHLHa46achaete-scute complex-like 1
  • Class A basic helix-loop-helix protein 46
  • HASH1
  • HASH1achaete scute protein
  • Mash1

Background

This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neurogenin-2
Antibody (2A8)
H00063973-M10
Western Blot: Neurogenin-2 Antibody (2A8) [H00063973-M10] - Analysis of NEUROG2 expression in H9c2 (2-1).
(1 Review)
Species: Hu, Rt
Applications: WB, ELISA
NeuroD1 Antibody
(3H8)
H00004760-M01
Western Blot: NeuroD1 Antibody (3H8) [H00004760-M01] - Analysis of NEUROD1 expression in transfected 293T cell line by NEUROD1 monoclonal antibody (M01), clone 3H8.Lane 1: NEUROD1 transfected lysate(39.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: NeuroD1 Antibody (3H8) [H00004760-M01] - Analysis of monoclonal antibody to NEUROD1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NeuroD1 Antibody (3H8) [H00004760-M01] - Analysis of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. Antibody concentration 3 ug/ml.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Neurogenin-1
Antibody (OTI3F9)
NBP1-47871
Western Blot: Neurogenin-1 Antibody (3F9) [NBP1-47871] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Neurogenin 1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Neurogenin-1 Antibody (3F9) [NBP1-47871] - Staining of COS7 cells.
Immunohistochemistry-Paraffin: Neurogenin-1 Antibody (3F9) [NBP1-47871] - Staining of Human prostate tissue.
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Hes1(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(5 Publications)
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
C21orf33 Antibody
(1F5)
H00008209-M01
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Notch-1 Antibody
(mN1A)
NB100-78486
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Notch-1 Antibody (mN1A) [NB100-78486] - Cell extracts from Jurkat (Lane 1) or mouse thymocytes (Lane 2) were Western Blot analyzed with monoclonal anti-NOTCH1 antibody. The mN1A antibody recognizes both mouse and human 270 kD full-length NOTCH1 and 110-120 kD cleaved NOTCH 1 (NICD).
Immunocytochemistry/Immunofluorescence: Notch-1 Antibody (mN1A) [NB100-78486] - The Notch1 Antibody was tested in HEK293 cells at a 1:50 dilution against Dylight 488 (Green). Actin was counterstained against Phalloidin 568 (Red) and cells were mounted in DAPI Flouromount (Blue).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Sonic Hedgehog/Shh
[Unconjugated]
461-SH/CF
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus (Catalog # 461-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.6‑3 μg/mL.
(25 Publications)
Species: Mu
Olig2 Antibody
[Unconjugated]
AF2418
A172 human glioblastoma cell line were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Olig2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse/Rat Olig2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2418) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Olig2 and Oligodendrocyte Marker O4 were detected in 7 day differentiated rat cortical stem cells using 10 µg/mL Goat Anti-Human/Mouse/Rat Olig2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2418) and 10 µg/mL Goat Anti-Human/Mouse/Rat/Chicken O4 Monoclonal Antibody (Catalog # MAB1326). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for Olig2 using the NorthernLights™ 637-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL002), and stained for O4 using an anti-mouse IgM secondary antibody (pseudo-stained green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Olig2 was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Human/Mouse/Rat Olig2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2418) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing brain. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(29 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, ChIP, ICC
BMP-2
[Unconjugated]
355-BM/CF
BMP-2 [Unconjugated]
(115 Publications)
Species: Hu, Mu, Rt
Tyrosine
Hydroxylase Antibody
NB300-109
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. Image from confirmed customer review.
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Analysis of Tyrosine Hydroxylase in rat mesenteric artery-whole. Image from verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Immunohistochemical staining of retina tissue using TH antibody, NB300-109.
(6 Reviews)
(77 Publications)
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
PHOX2B Antibody
[Unconjugated]
AF4940
PHOX2B was detected in immersion fixed IMR-32 human neuroblastoma cell line using Goat Anti-Human PHOX2B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4940) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu
Applications: ICC
SS18L1 Antibody
NBP2-20486
Western Blot: SS18L1 Antibody [NBP2-20486] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SS18L1 Antibody [NBP2-20486] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: SS18L1 Antibody [NBP2-20486] - Immunohistochemical analysis of paraffin-embedded Huh-7 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Chromogranin A
Antibody
NB120-15160
Immunohistochemistry-Paraffin: Chromogranin A Antibody [NB120-15160] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse pancreas using Chromogranin A antibody at a dilution of 1:500. The signal was developed using HRP-conjugated anti-rabbit secondary and DAB reagent which followed counterstaining of the section with hematoxylin. The antibody generated a strong staining in Islets of Langerhans. Also, in the periphery of the cells, the pattern of staining was punctate representing the vesicles with Chromogranin A. Cells of lobules and acini showed a weak cytoplasmic and nuclear staining which is potentially the secreted pool of Chromogranin A.
Immunohistochemistry: Chromogranin A Antibody [NB120-15160] - IHC-P analysis fo human pancreas tissue showing specific staining of Chromogranin A in the Islets of Langerhans (dark brown staining).
Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NB120-15160] - SH-SY5Y cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Chromogranin A at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Pax6 Antibody
NB300-750
Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract
Immunocytochemistry: Pax6 Antibody [NB300-750] - ARPE-19 monolayer on glass substrate. Fixative Methanol Blocking Goat Serum. Dilution 1:100. Incubation 1h @ RT. This image was submitted via customer Review.
Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract
(4 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
HES5 Antibody
NBP2-41305
Western Blot: HES5 Antibody [NBP2-41305] - Western blot analysis of HES5 in Raji cell lysate with HES5 antibody at 1 ug/ml (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with HES5 Antibodyat 20 ug/mL.
Immunohistochemistry: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with HES5 Antibodyat 5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
FGF basic/FGF2
[Unconjugated]
233-FB/CF
1 µg/lane of Recombinant Human FGF basic (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human FGF basic (146aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 0.1-0.6 ng/mL.
(231 Publications)
Species: Hu
TTF1 / NKX2.1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry-Paraffin: TTF1 / NKX2.1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin: TTF1 / NKX2.1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for ASCL1/Mash1 Antibody (H00000429-M02) (0)

There are no publications for ASCL1/Mash1 Antibody (H00000429-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL1/Mash1 Antibody (H00000429-M02) (0)

There are no reviews for ASCL1/Mash1 Antibody (H00000429-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASCL1/Mash1 Antibody (H00000429-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASCL1/Mash1 Products

Bioinformatics Tool for ASCL1/Mash1 Antibody (H00000429-M02)

Discover related pathways, diseases and genes to ASCL1/Mash1 Antibody (H00000429-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL1/Mash1 Antibody (H00000429-M02)

Discover more about diseases related to ASCL1/Mash1 Antibody (H00000429-M02).
 

Pathways for ASCL1/Mash1 Antibody (H00000429-M02)

View related products by pathway.

PTMs for ASCL1/Mash1 Antibody (H00000429-M02)

Learn more about PTMs related to ASCL1/Mash1 Antibody (H00000429-M02).
 

Research Areas for ASCL1/Mash1 Antibody (H00000429-M02)

Find related products by research area.

Blogs on ASCL1/Mash1

There are no specific blogs for ASCL1/Mash1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASCL1/Mash1 Antibody (2D9) and receive a gift card or discount.


Bioinformatics

Gene Symbol ASCL1
Entrez
OMIM
Uniprot