ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody - BSA Free

Western Blot: ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody [NBP2-49326] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG

Immunocytochemistry/Immunofluorescence: ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody [NBP2-49326] - Immunofluorescent staining of human cell line U-251 MG shows localization to focal adhesion sites.

Immunohistochemistry-Paraffin: ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody [NBP2-49326] - Staining of human duodenum shows luminal membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASAH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ASAH2/N-acylsphingosine Amidohydrolase-2 Recombinant Protein Antigen (NBP2-49326PEP)

Reactivity Notes

Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody - BSA Free

• ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2
• ASAH2
• BCDase
• HNAC1
• LCDase
• Nacylsphingosine Amidohydrolase2
• NCDase
• N-CDase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASAH2