Arylsulfatase B/ARSB Antibody (2G6)

Images

 
Sandwich ELISA: Arylsulfatase B/ARSB Antibody (2G6) [H00000411-M10] - Detection limit for recombinant GST tagged ARSB is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Arylsulfatase B/ARSB Antibody (2G6) Summary

Immunogen
ARSB (NP_942002, 166 a.a. - 265 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARSB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Arylsulfatase B/ARSB Antibody (2G6)

  • ARSB
  • Arylsulfatase B
  • ASB
  • EC 3.1.6.12
  • G4S
  • MPS6
  • N-acetylgalactosamine-4-sulfatase

Background

Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
H00000411-M10
Species: Hu
Applications: WB, ELISA

Publications for Arylsulfatase B/ARSB Antibody (H00000411-M10) (0)

There are no publications for Arylsulfatase B/ARSB Antibody (H00000411-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arylsulfatase B/ARSB Antibody (H00000411-M10) (0)

There are no reviews for Arylsulfatase B/ARSB Antibody (H00000411-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arylsulfatase B/ARSB Antibody (H00000411-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arylsulfatase B/ARSB Products

Bioinformatics Tool for Arylsulfatase B/ARSB Antibody (H00000411-M10)

Discover related pathways, diseases and genes to Arylsulfatase B/ARSB Antibody (H00000411-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arylsulfatase B/ARSB Antibody (H00000411-M10)

Discover more about diseases related to Arylsulfatase B/ARSB Antibody (H00000411-M10).
 

Pathways for Arylsulfatase B/ARSB Antibody (H00000411-M10)

View related products by pathway.

PTMs for Arylsulfatase B/ARSB Antibody (H00000411-M10)

Learn more about PTMs related to Arylsulfatase B/ARSB Antibody (H00000411-M10).

Blogs on Arylsulfatase B/ARSB

There are no specific blogs for Arylsulfatase B/ARSB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arylsulfatase B/ARSB Antibody (2G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSB
Entrez
Uniprot