Arrestin 3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ARR3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Arrestin 3 Antibody - BSA Free
Background
Arrestin-C, also known as retinal cone arrestin-3, is a protein involved in the regulation of retinal cone-specific photo signal transduction. Arrestin 3 antibodies are useful for phototransduciton studies and general vision research.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: WB
Publications for Arrestin 3 Antibody (NBP2-68802) (0)
There are no publications for Arrestin 3 Antibody (NBP2-68802).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Arrestin 3 Antibody (NBP2-68802) (0)
There are no reviews for Arrestin 3 Antibody (NBP2-68802).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Arrestin 3 Antibody (NBP2-68802) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Arrestin 3 Products
Research Areas for Arrestin 3 Antibody (NBP2-68802)
Find related products by research area.
|
Blogs on Arrestin 3