Arrestin 3 Antibody

Images

 
Western Blot: Arrestin 3 Antibody [NBP1-69084] - Human Fetal Lung Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arrestin 3 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARR3 (arrestin 3, retinal (X-arrestin)) The peptide sequence was selected from the C terminal of ARR3. Peptide sequence DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARR3 and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Arrestin 3 Antibody

  • arrestin 3, retinal (X-arrestin)
  • arrestin 4
  • arrestin-C
  • ARRXcArr
  • CAR
  • C-arrestin
  • Cone arrestin
  • Retinal cone arrestin-3
  • X-arrestin

Background

ARR3 may play a role in an as yet undefined retina-specific signal transduction. 'ARR3 could binds to photoactivated-phosphorylated red/green opsins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
AF7356
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Arrestin 3 Antibody (NBP1-69084) (0)

There are no publications for Arrestin 3 Antibody (NBP1-69084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arrestin 3 Antibody (NBP1-69084) (0)

There are no reviews for Arrestin 3 Antibody (NBP1-69084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arrestin 3 Antibody (NBP1-69084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arrestin 3 Products

Bioinformatics Tool for Arrestin 3 Antibody (NBP1-69084)

Discover related pathways, diseases and genes to Arrestin 3 Antibody (NBP1-69084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arrestin 3 Antibody (NBP1-69084)

Discover more about diseases related to Arrestin 3 Antibody (NBP1-69084).
 

Pathways for Arrestin 3 Antibody (NBP1-69084)

View related products by pathway.

PTMs for Arrestin 3 Antibody (NBP1-69084)

Learn more about PTMs related to Arrestin 3 Antibody (NBP1-69084).
 

Research Areas for Arrestin 3 Antibody (NBP1-69084)

Find related products by research area.

Blogs on Arrestin 3

There are no specific blogs for Arrestin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arrestin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARR3