ARPP19 Antibody

Images

 
Immunohistochemistry-Paraffin: ARPP19 Antibody [NBP2-31652] - Staining of human cerebral cortex shows strong Cytoplasmic positivity in neuropil.
Immunohistochemistry: ARPP19 Antibody [NBP2-31652] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry: ARPP19 Antibody [NBP2-31652] - Staining of adrenal gland.
Immunohistochemistry: ARPP19 Antibody [NBP2-31652] - Staining of liver cancer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARPP19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARPP19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARPP19 Protein (NBP2-31652PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARPP19 Antibody

  • ARPP-16
  • ARPP16cAMP-regulated phosphoprotein 19
  • ARPP-19FLJ41622
  • cAMP-regulated phosphoprotein, 19kDa
  • cyclic AMP phosphoprotein, 19 kD
  • ENSAL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13963
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90096
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31652
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ARPP19 Antibody (NBP2-31652) (0)

There are no publications for ARPP19 Antibody (NBP2-31652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARPP19 Antibody (NBP2-31652) (0)

There are no reviews for ARPP19 Antibody (NBP2-31652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARPP19 Antibody (NBP2-31652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARPP19 Products

Bioinformatics Tool for ARPP19 Antibody (NBP2-31652)

Discover related pathways, diseases and genes to ARPP19 Antibody (NBP2-31652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARPP19 Antibody (NBP2-31652)

Discover more about diseases related to ARPP19 Antibody (NBP2-31652).
 

Pathways for ARPP19 Antibody (NBP2-31652)

View related products by pathway.

PTMs for ARPP19 Antibody (NBP2-31652)

Learn more about PTMs related to ARPP19 Antibody (NBP2-31652).

Blogs on ARPP19

There are no specific blogs for ARPP19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARPP19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARPP19
Uniprot