ARMCX2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARMCX2 Antibody [NBP1-89144] - Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ARMCX2 Antibody [NBP1-89144] - Staining of human pancreas shows moderate cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMCX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMCX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARMCX2 Protein (NBP1-89144PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMCX2 Antibody

  • armadillo repeat containing, X-linked 2
  • armadillo repeat protein ALEX2
  • armadillo repeat-containing X-linked protein 2
  • MGC8742
  • Protein ALEX2
  • X chromosome, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89142
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-501
Species: Hu, Mu
Applications: WB, IP
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56552
Species: Hu
Applications: WB
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89300
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
3008-WN/CF
Species: Hu
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ARMCX2 Antibody (NBP1-89144) (0)

There are no publications for ARMCX2 Antibody (NBP1-89144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX2 Antibody (NBP1-89144) (0)

There are no reviews for ARMCX2 Antibody (NBP1-89144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARMCX2 Antibody (NBP1-89144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMCX2 Products

Bioinformatics Tool for ARMCX2 Antibody (NBP1-89144)

Discover related pathways, diseases and genes to ARMCX2 Antibody (NBP1-89144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMCX2 Antibody (NBP1-89144)

Discover more about diseases related to ARMCX2 Antibody (NBP1-89144).
 

Pathways for ARMCX2 Antibody (NBP1-89144)

View related products by pathway.

PTMs for ARMCX2 Antibody (NBP1-89144)

Learn more about PTMs related to ARMCX2 Antibody (NBP1-89144).

Blogs on ARMCX2

There are no specific blogs for ARMCX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMCX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMCX2
Entrez
Uniprot