ARMCX3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARMCX3 Antibody [NBP1-89142] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ARMCX3 Antibody [NBP1-89142] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunocytochemistry/Immunofluorescence: ARMCX3 Antibody [NBP1-89142] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARMCX3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARMCX3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ARMCX3 Protein (NBP1-89142PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARMCX3 Antibody - BSA Free

• ALEX3arm protein lost in epithelial cancers, X chromosome, 3
• ARM protein lost in epithelial cancers on chromosome X 3
• armadillo repeat containing, X-linked 3
• armadillo repeat-containing X-linked protein 3,1200004E24Rik
• dJ545K15.2
• DKFZp781N1954
• KIAA0443
• MGC12199
• Protein ALEX3

Background

ARMCX3 encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARMCX3 Antibody (NBP1-89142)(1)

Publication using NBP1-89142

• Mou Z, Tapper AR, Gardner PD et al. The armadillo repeat-containing protein, ARMCX3, physically and functionally interacts with the developmental regulatory factor Sox10. J Biol Chem 2009-05-01 [PMID: 19304657]

Bioinformatics

• Gene Symbol: ARMCX3
• Entrez:
  • 51566(Human)
• Uniprot:
  • Q9UH62(Human)