ARMCX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARMCX1 Antibody [NBP1-89145] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: ARMCX1 Antibody [NBP1-89145] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMCX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMCX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARMCX1 Protein (NBP1-89145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMCX1 Antibody

  • ALEX1armadillo repeat-containing X-linked protein 1
  • ARM protein lost in epithelial cancers on chromosome X 1
  • arm protein lost in epithelial cancers, X chromosome, 1
  • armadillo repeat containing, X-linked 1
  • DKFZp686P06199
  • Protein ALEX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89144
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-89142
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
NBP1-90642
Species: Hu
Applications: IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27152
Species: Mu
Applications: WB
AF7179
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
AF1734
Species: Hu
Applications: WB, IP
NBP1-89145
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ARMCX1 Antibody (NBP1-89145) (0)

There are no publications for ARMCX1 Antibody (NBP1-89145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMCX1 Antibody (NBP1-89145) (0)

There are no reviews for ARMCX1 Antibody (NBP1-89145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARMCX1 Antibody (NBP1-89145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMCX1 Products

Bioinformatics Tool for ARMCX1 Antibody (NBP1-89145)

Discover related pathways, diseases and genes to ARMCX1 Antibody (NBP1-89145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMCX1 Antibody (NBP1-89145)

Discover more about diseases related to ARMCX1 Antibody (NBP1-89145).
 

Pathways for ARMCX1 Antibody (NBP1-89145)

View related products by pathway.

PTMs for ARMCX1 Antibody (NBP1-89145)

Learn more about PTMs related to ARMCX1 Antibody (NBP1-89145).

Blogs on ARMCX1

There are no specific blogs for ARMCX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMCX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMCX1
Entrez
Uniprot