ARIH1 Antibody

Images

 
Western Blot: ARIH1 Antibody [NBP1-88984] - Analysis in control (vector only transfected HEK293T lysate) and LY417059 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ARIH1 Antibody [NBP1-88984] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARIH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQHMVECIREVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARIH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARIH1 Recombinant Protein Antigen (NBP1-88984PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARIH1 Antibody

  • ARI-1
  • ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1(Drosophila)
  • ariadne, Drosophila, homolog of
  • ARIMOP-6
  • FLJ20329
  • FLJ93118
  • H7-AP2
  • HARI
  • Monocyte protein 6
  • MOP6
  • protein ariadne-1 homolog
  • UbcH7-binding protein
  • UBCH7BPariadne (Drosophila) homolog, ubiquitin-conjugating enzyme E2-binding protein1,HHARIDKFZp686O13120
  • UbcM4-interacting protein
  • Ubiquitin-conjugating enzyme E2-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
AF3749
Species: Hu
Applications: WB, IHC
NBP1-88984
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ARIH1 Antibody (NBP1-88984) (0)

There are no publications for ARIH1 Antibody (NBP1-88984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARIH1 Antibody (NBP1-88984) (0)

There are no reviews for ARIH1 Antibody (NBP1-88984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARIH1 Antibody (NBP1-88984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARIH1 Products

Bioinformatics Tool for ARIH1 Antibody (NBP1-88984)

Discover related pathways, diseases and genes to ARIH1 Antibody (NBP1-88984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARIH1 Antibody (NBP1-88984)

Discover more about diseases related to ARIH1 Antibody (NBP1-88984).
 

Pathways for ARIH1 Antibody (NBP1-88984)

View related products by pathway.

PTMs for ARIH1 Antibody (NBP1-88984)

Learn more about PTMs related to ARIH1 Antibody (NBP1-88984).

Blogs on ARIH1

There are no specific blogs for ARIH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARIH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARIH1