ARID5B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARID5B Antibody [NBP1-83622] - Staining of human cell line BJ shows localization to nucleoplasm & endoplasmic reticulum. Antibody staining is shown in green.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARID5B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARID5B Antibody - BSA Free (NBP1-83622) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and ChIP. Anti-ARID5B Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARID5B Protein (NBP1-83622PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24276541).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARID5B Antibody - BSA Free

• ARID domain-containing protein 5B
• AT rich interactive domain 5B (MRF1-like)
• DESRTAT-rich interactive domain-containing protein 5B
• FLJ21150
• modulator recognition factor 2 (MRF2)
• Modulator recognition factor 2
• MRF-2
• MRF2MRF1-like protein

Background

ARID5B (AT-rich interactive domain-containing protein 5B) is also known as MRF-2 (modulator recognition factor 2) and is member of the AT-rich interaction domain (ARID) family of proteins. Studies of ARID5B in knockout mice indicate a role in the regulation of adipocyte differentiation and leptin expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARID5B Antibody (NBP1-83622)(8)

Publications using NBP1-83622

• Tagawa Y, Saito T, Iwai H et al. ARID5B is a negative modulator of IL-6 production in rheumatoid arthritis synovial fibroblasts. Immunological medicine 2024-08-22 [PMID: 38747454]
• Tan Y, Qiao J, Yang S et Al. ARID5B-mediated LINC01128 epigenetically activated pyroptosis and apoptosis by promoting the formation of the BTF3/STAT3 complex in ?2GPI/anti-?2GPI-treated monocytes Clin Transl Med 2024-01-15 [PMID: 38224186]
• Deng Y, Dong Y, Wu L et al. ARID5B promoted the histone demethylation of SORBS2 and hampered the metastasis of Ovarian cancer Pathology - Research and Practice 2023-11-01 [PMID: 37948999] (Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP), Immunocytochemistry/ Immunofluorescence, Human)
• Xiang Y, Liang B, Zhang X et al. Atheroprotective mechanism by which folic acid regulates monocyte subsets and function through DNA methylation Clinical epigenetics 2022-02-28 [PMID: 35227297] (WB, Human)
• Xu H, Zhao X, Bhojwani D et al. ARID5B influences anti-metabolite drug sensitivity and prognosis of acute lymphoblastic leukemia Clin. Cancer Res. 2019-10-01 [PMID: 31573954] (Chemotaxis, Human)
• Cichocki F, Wu CY, Zhang B et al. ARID5B regulates metabolic programming in human adaptive NK cells J. Exp. Med. 2018-07-30 [PMID: 30061358] (WB, Chemotaxis, Human)
• Nestor CE, Ottaviano R, Reinhardt D et al. Rapid reprogramming of epigenetic and transcriptional profiles in mammalian culture systems Genome Biol. 2015-02-04 [PMID: 25648825] (ICC/IF, Mouse)
• Hata K, Takashima R, Amano K et al. Arid5b facilitates chondrogenesis by recruiting the histone demethylase Phf2 to Sox9-regulated genes. Nat Commun. 2013-11-26 [PMID: 24276541] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: ARID5B