ARHGEF40 Antibody - BSA Free

Immunohistochemistry-Paraffin: Solo Antibody [NBP1-83864] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in subsets of glial cells.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-2 OS

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGEF40 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGEF40 Antibody - BSA Free (NBP1-83864) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPSPPLPEEALGTRSPGDGHNAPVEGPEGEYVELLEVTLPVRGSPTDAEGSPGLSRVRTVPTRKGAGGKGRHRRHRAWMHQKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARHGEF40 Recombinant Protein Antigen (NBP1-83864PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGEF40 Antibody - BSA Free

• FLJ10357
• protein SOLO
• Rho guanine nucleotide exchange factor (GEF) 40
• rho guanine nucleotide exchange factor 40
• SOLO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF40