ARH Antibody [Janelia Fluor® 525]

Product Discontinued

ARH Antibody [Janelia Fluor® 525] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-308 of human ARH (NP_056442.2).
  
  Sequence:
  EQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LDLRAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for ARH Antibody [Janelia Fluor® 525]

• ARH1
• ARH2
• ARHAutosomal recessive hypercholesterolemia protein
• DKFZp586D0624
• FHCB1ARH1
• FHCB2LDL receptor adaptor protein
• low density lipoprotein receptor adapter protein 1
• low density lipoprotein receptor adaptor protein 1
• MGC34705

Background

ARH is encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LDLRAP1