Recombinant Human ARA54 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARA54 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-348 of Human RNF14 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RNF14

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARA54 Protein

  • Androgen receptor-associated protein 54
  • ARA54
  • ARA54androgen receptor associated protein 54
  • EC 6.3.2.-
  • HFB30
  • HFB30E3 ubiquitin-protein ligase RNF14
  • ring finger protein 14FLJ26004
  • RNF14
  • Triad2 protein
  • TRIAD2

Background

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF5626
Species: Hu
Applications: WB, ICC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-1744
Species: Hu
Applications: IHC-P
H00005956-R02
Species: Hu
H00009604-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARA54 Recombinant Protein (H00009604-P01) (0)

There are no publications for ARA54 Recombinant Protein (H00009604-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARA54 Recombinant Protein (H00009604-P01) (0)

There are no reviews for ARA54 Recombinant Protein (H00009604-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARA54 Recombinant Protein (H00009604-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARA54 Products

Bioinformatics Tool for ARA54 Recombinant Protein (H00009604-P01)

Discover related pathways, diseases and genes to ARA54 Recombinant Protein (H00009604-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARA54 Recombinant Protein (H00009604-P01)

Discover more about diseases related to ARA54 Recombinant Protein (H00009604-P01).
 

Pathways for ARA54 Recombinant Protein (H00009604-P01)

View related products by pathway.

PTMs for ARA54 Recombinant Protein (H00009604-P01)

Learn more about PTMs related to ARA54 Recombinant Protein (H00009604-P01).
 

Research Areas for ARA54 Recombinant Protein (H00009604-P01)

Find related products by research area.

Blogs on ARA54

There are no specific blogs for ARA54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARA54 Antibody
NBP1-89021

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARA54 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF14
Entrez