We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ARA54 Recombinant Protein Antigen

Images

 
There are currently no images for ARA54 Recombinant Protein Antigen (NBP3-17686PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ARA54 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARA54

Source: E. coli

Amino Acid Sequence: TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17686.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARA54 Recombinant Protein Antigen

  • Androgen receptor-associated protein 54
  • ARA54
  • ARA54androgen receptor associated protein 54
  • EC 6.3.2.-
  • HFB30
  • HFB30E3 ubiquitin-protein ligase RNF14
  • ring finger protein 14FLJ26004
  • RNF14
  • Triad2 protein
  • TRIAD2

Background

RNF14 is encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
H00008031-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF5626
Species: Hu
Applications: ICC, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NBP1-90117
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-90363
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00064324-M08
Species: Hu
Applications: ELISA, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP3-17686PEP
Species: Hu
Applications: AC

Publications for ARA54 Recombinant Protein Antigen (NBP3-17686PEP) (0)

There are no publications for ARA54 Recombinant Protein Antigen (NBP3-17686PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARA54 Recombinant Protein Antigen (NBP3-17686PEP) (0)

There are no reviews for ARA54 Recombinant Protein Antigen (NBP3-17686PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARA54 Recombinant Protein Antigen (NBP3-17686PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARA54 Products

Research Areas for ARA54 Recombinant Protein Antigen (NBP3-17686PEP)

Find related products by research area.

Blogs on ARA54

There are no specific blogs for ARA54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARA54 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF14