Aquaporin-10 Antibody


Western Blot: Aquaporin-10 Antibody [NBP1-69625] - Aquaporin-10 Antibody This Anti-AQP10 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Aquaporin-10 Antibody Summary

Synthetic peptides corresponding to AQP10(aquaporin 10) The peptide sequence was selected from the C terminal of AQP10. Peptide sequence VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AQP10 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aquaporin-10 Antibody

  • AQP-10
  • aquaglyceroporin-10
  • aquaporin 10
  • aquaporin-10
  • Small intestine aquaporin


Aquaporin-10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. Aquaporin-10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB

Publications for Aquaporin-10 Antibody (NBP1-69625) (0)

There are no publications for Aquaporin-10 Antibody (NBP1-69625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin-10 Antibody (NBP1-69625) (0)

There are no reviews for Aquaporin-10 Antibody (NBP1-69625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aquaporin-10 Antibody (NBP1-69625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Aquaporin-10 Products

Bioinformatics Tool for Aquaporin-10 Antibody (NBP1-69625)

Discover related pathways, diseases and genes to Aquaporin-10 Antibody (NBP1-69625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-10 Antibody (NBP1-69625)

Discover more about diseases related to Aquaporin-10 Antibody (NBP1-69625).

Pathways for Aquaporin-10 Antibody (NBP1-69625)

View related products by pathway.

PTMs for Aquaporin-10 Antibody (NBP1-69625)

Learn more about PTMs related to Aquaporin-10 Antibody (NBP1-69625).

Blogs on Aquaporin-10

There are no specific blogs for Aquaporin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aquaporin-10 Antibody and receive a gift card or discount.


Gene Symbol AQP10