Aquaporin-10 Antibody

Images

 
Western Blot: Aquaporin-10 Antibody [NBP1-62621] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aquaporin-10 Antibody Summary

Immunogen
Synthetic peptides corresponding to AQP10(aquaporin 10) The peptide sequence was selected from the middle region of AQP10 (NP_536354). Peptide sequence VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AQP10 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-62621.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aquaporin-10 Antibody

  • AQP-10
  • AQPA_HUMAN
  • aquaglyceroporin-10
  • aquaporin 10
  • aquaporin-10
  • Small intestine aquaporin

Background

AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea. This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97927
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30862
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-30865
Species: Hu
Applications: IHC, IHC-P, WB
NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-92557
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-69822
Species: Hu
Applications: ELISA
NBP2-54696
Species: Hu
Applications: IHC, IHC-P
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67247
Species: Hu
Applications: ICC/IF, WB
NBP1-90119
Species: Hu
Applications: IHC, IHC-P
NB300-318
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
NBP1-86521
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-62621
Species: Hu
Applications: WB

Publications for Aquaporin-10 Antibody (NBP1-62621)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-62621 Applications Species
Li,H. Biol. Cell 97 (11), 823-829. 2005 [PMID: 15898950]

Reviews for Aquaporin-10 Antibody (NBP1-62621) (0)

There are no reviews for Aquaporin-10 Antibody (NBP1-62621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aquaporin-10 Antibody (NBP1-62621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Aquaporin-10 Products

Bioinformatics Tool for Aquaporin-10 Antibody (NBP1-62621)

Discover related pathways, diseases and genes to Aquaporin-10 Antibody (NBP1-62621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-10 Antibody (NBP1-62621)

Discover more about diseases related to Aquaporin-10 Antibody (NBP1-62621).
 

Pathways for Aquaporin-10 Antibody (NBP1-62621)

View related products by pathway.

PTMs for Aquaporin-10 Antibody (NBP1-62621)

Learn more about PTMs related to Aquaporin-10 Antibody (NBP1-62621).

Blogs on Aquaporin-10

There are no specific blogs for Aquaporin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aquaporin-10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP10
Entrez
Uniprot