Apolipoprotein L1 Antibody (1A8N2)

Western Blot: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407] - Western blot analysis of extracts of various cell lines, using Apolipoprotein L1 Rabbit mAb (NBP3-16407) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407] - Confocal imaging of Hep G2 cells using Apolipoprotein L1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1A8N2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Apolipoprotein L1 Antibody (1A8N2) Summary

• Description: Novus Biologicals Rabbit Apolipoprotein L1 Antibody (1A8N2) (NBP3-16407) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human Apolipoprotein L1 (O14791). RPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: APOL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Apolipoprotein L1 Antibody (1A8N2)

• APOL
• APO-L
• APOL1
• APO-L1
• APO-LI
• APOL-I
• Apolipoprotein L
• apolipoprotein L, 1
• Apolipoprotein L1
• Apolipoprotein L-I
• FSGS4

Background

Apolipoproteins are protein components of plasma lipoproteins. The apolipoprotein L gene family encodes six highly homologous proteins designated apoL-I to -VI, which are associated with large high density type lipoproteins (HDL). The human apoL family maps to chromosome 22q12.1- 13.1 within a 127,000-bp region . apoL has been characterized as a pancreas specific, 383-amino acid, 42 kDa protein that contains a 12-amino acid secretory signal peptide. The apoL genes have TATA-less promoters and contain putative sterol regulatory elements, suggesting that transcription of these genes may be coordinated with that of the low density lipoprotein receptor and genes in pathways involving the synthesis of triglycerides and cholesterol. apoL homologs can undergo 10 fold changes in expression during atherosclerotic changes in vascular endothelial cells, which includes the inflammatory reaction of atherosclerotic lesions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOL1