Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

Images

 
There are currently no images for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOA4.

Source: E. coli

Amino Acid Sequence: DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86164.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

  • apo-AIV
  • apoA-IV
  • Apolipoprotein A4
  • Apolipoprotein AIV
  • Apolipoprotein A-IV
  • MGC142154
  • MGC142156

Background

Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3664
Species: Hu
Applications: Simple Western, WB
NBP2-92734
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16168
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
AF4497
Species: Hu
Applications: Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
MAB8306
Species: Hu
Applications: IHC, WB
NB400-139
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF3556
Species: Hu
Applications: IHC, Simple Western, WB
DHAPG0
Species: Hu
Applications: ELISA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB400-107
Species: Hu, Mu
Applications: ELISA, WB
NBP1-89330
Species: Hu
Applications: IHC,  IHC-P
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
H00005355-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-86164PEP
Species: Hu
Applications: AC

Publications for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP) (0)

There are no publications for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP) (0)

There are no reviews for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP). (Showing 1 - 1 of 1 FAQ).

  1. I would like to buy antibodies APOA4 (apolipoprotein AIV) for the cows (to western blot). I know that You don't have the antibodies for this species. Could You propose the best atibodies which I could test (use) in my experiment?
    • All eight of our APOA4 antibodies were raised against the human protein, and all of them have currently only been tested against human samples. I ran an alignment for you and found that there is a 77% sequence homology between human and bovine APOA4, so it is possible that the antibodies raised against human APOA4 may recognise the bovine protein. Should you wish to try any of our antibodies with your samples, you may be interested in our Innovator's Reward Program, which allows you to try our primary antibodies in an untested species or application without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product.

Additional Apolipoprotein A-IV/ApoA4 Products

Research Areas for Apolipoprotein A-IV/ApoA4 Protein (NBP1-86164PEP)

Find related products by research area.

Blogs on Apolipoprotein A-IV/ApoA4

There are no specific blogs for Apolipoprotein A-IV/ApoA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA4