APOL3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: APOL3 Antibody [NBP2-55075] - Staining of human cell line A-431 shows localization to nuclear bodies & mitochondria. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APOL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit APOL3 Antibody - BSA Free (NBP2-55075) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  APOL3 Recombinant Protein Antigen (NBP2-55075PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for APOL3 Antibody - BSA Free

• APOLIII
• apoL-III
• apolipoprotein L, 3
• apolipoprotein L3
• Apolipoprotein L-III
• CG12_1
• CG121
• CG12-1
• TNF-inducible protein CG12-1

Background

APOL3 is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. In addition, expression of this gene is upregulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Six transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOL3