APOBEC4 Antibody

Images

 
Immunohistochemistry: APOBEC4 Antibody [NBP1-88490] - Staining of human blood vessel shows distinct positivity in internal elastic lamina.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOBEC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APOBEC4 Protein (NBP1-88490PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOBEC4 Antibody

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative)
  • Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 4
  • C1orf169
  • chromosome 1 open reading frame 169
  • EC 3.5.4.-
  • FLJ25691
  • MGC26594
  • putative C->U-editing enzyme APOBEC-4
  • RP1-127C7.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06977
Species: Mu
Applications: WB, PEP-ELISA
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-84285
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-31732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88490
Species: Hu
Applications: IHC, IHC-P

Publications for APOBEC4 Antibody (NBP1-88490) (0)

There are no publications for APOBEC4 Antibody (NBP1-88490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC4 Antibody (NBP1-88490) (0)

There are no reviews for APOBEC4 Antibody (NBP1-88490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APOBEC4 Antibody (NBP1-88490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOBEC4 Products

Bioinformatics Tool for APOBEC4 Antibody (NBP1-88490)

Discover related pathways, diseases and genes to APOBEC4 Antibody (NBP1-88490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC4 Antibody (NBP1-88490)

Discover more about diseases related to APOBEC4 Antibody (NBP1-88490).
 

Pathways for APOBEC4 Antibody (NBP1-88490)

View related products by pathway.

PTMs for APOBEC4 Antibody (NBP1-88490)

Learn more about PTMs related to APOBEC4 Antibody (NBP1-88490).

Blogs on APOBEC4

There are no specific blogs for APOBEC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOBEC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC4