APOBEC4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
APOBEC4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for APOBEC4 Antibody - BSA Free
Background
APOBEC4 encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for APOBEC4 Antibody (NBP1-88490) (0)
There are no publications for APOBEC4 Antibody (NBP1-88490).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for APOBEC4 Antibody (NBP1-88490) (0)
There are no reviews for APOBEC4 Antibody (NBP1-88490).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for APOBEC4 Antibody (NBP1-88490) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional APOBEC4 Products
Research Areas for APOBEC4 Antibody (NBP1-88490)
Find related products by research area.
|
Blogs on APOBEC4