ADAT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAT2 Antibody [NBP1-84285] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAT2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADAT2 Protein (NBP1-84285PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADAT2 Antibody - BSA Free

• adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
• DEADC1
• deaminase domain containing 1
• Deaminase domain-containing protein 1
• dJ20N2
• dJ20N2.1
• DKFZp686L1118
• EC 3.5.4
• EC 3.5.4.-
• FLJ44213
• TAD2
• tRNA-specific adenosine deaminase 2 homolog
• tRNA-specific adenosine deaminase 2
• tRNA-specific adenosine-34 deaminase subunit ADAT2

Background

Probably participates in deamination of adenosine-34 to inosine in many tRNAs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAT2
• Entrez:
  • 134637(Human)
• Uniprot:
  • Q7Z6V5(Human)