ADAT2 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: ADAT2 Antibody [NBP1-84285] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ADAT2 Antibody [NBP1-84285] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ADAT2 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ADAT2 Antibody - BSA Free (NBP1-84285) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAT2 Protein (NBP1-84285PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAT2 Antibody - BSA Free

  • adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)
  • DEADC1
  • deaminase domain containing 1
  • Deaminase domain-containing protein 1
  • dJ20N2
  • dJ20N2.1
  • DKFZp686L1118
  • EC 3.5.4
  • EC 3.5.4.-
  • FLJ44213
  • TAD2
  • tRNA-specific adenosine deaminase 2 homolog
  • tRNA-specific adenosine deaminase 2
  • tRNA-specific adenosine-34 deaminase subunit ADAT2

Background

Probably participates in deamination of adenosine-34 to inosine in many tRNAs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31732
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP2-29865
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF-410-NA
Species: Hu, Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
NBP2-20254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-84285
Species: Hu
Applications: ICC/IF, IHC

Publications for ADAT2 Antibody (NBP1-84285) (0)

There are no publications for ADAT2 Antibody (NBP1-84285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAT2 Antibody (NBP1-84285) (0)

There are no reviews for ADAT2 Antibody (NBP1-84285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAT2 Antibody (NBP1-84285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAT2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAT2
Entrez
Uniprot