APJ/Apelin receptor Antibody - BSA Free

Western Blot: APJ/Apelin receptor Antibody [NBP1-68946] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

APJ/Apelin receptor Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to APLNR (apelin receptor) The peptide sequence was selected form the N terminal of APLNR. Peptide sequence NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APLNR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for APJ/Apelin receptor Antibody - BSA Free

• AGTRL1
• AGTRL1HG11
• angiotensin II receptor-like 1
• Angiotensin receptor-like 1
• apelin receptor
• APJ (apelin) receptor
• APJ receptor
• APJ
• APJFLJ96609
• APJR
• APLNR
• FLJ90771
• G protein-coupled receptor APJ
• G-protein coupled receptor APJ
• G-protein coupled receptor HG11
• HG11 orphan receptor
• HG11
• MGC45246

Background

This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APLNR
• OMIM:
  • NP_005152(Human)
• Uniprot:
  • P35414()