APEG1 Antibody

Images

 
Immunohistochemistry: APEG1 Antibody [NBP1-90134] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APEG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPEG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 25087613)
Control Peptide
APEG1 Protein (NBP1-90134PEP)
Publications
Read Publication using NBP1-90134.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APEG1 Antibody

  • aortic preferentially expressed gene 1
  • Aortic preferentially expressed protein 1
  • APEG1
  • BPEG
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1297APEG-1
  • MGC12676
  • nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury
  • SPEG complex locus
  • SPEGalpha
  • SPEGbeta
  • striated muscle preferentially expressed protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33726
Species: Hu
Applications: IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA

Publications for APEG1 Antibody (NBP1-90134)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for APEG1 Antibody (NBP1-90134) (0)

There are no reviews for APEG1 Antibody (NBP1-90134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APEG1 Antibody (NBP1-90134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APEG1 Products

Bioinformatics Tool for APEG1 Antibody (NBP1-90134)

Discover related pathways, diseases and genes to APEG1 Antibody (NBP1-90134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APEG1 Antibody (NBP1-90134)

Discover more about diseases related to APEG1 Antibody (NBP1-90134).
 

Pathways for APEG1 Antibody (NBP1-90134)

View related products by pathway.

PTMs for APEG1 Antibody (NBP1-90134)

Learn more about PTMs related to APEG1 Antibody (NBP1-90134).
 

Research Areas for APEG1 Antibody (NBP1-90134)

Find related products by research area.

Blogs on APEG1

There are no specific blogs for APEG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APEG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPEG
Entrez
Uniprot