APEG1 Antibody


Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining in human heart muscle and liver tissues using anti-SPEG antibody. Corresponding SPEG RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

APEG1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV
Specificity of human APEG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 25087613)
Control Peptide
APEG1 Protein (NBP1-90134PEP)
Read Publication using NBP1-90134.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for APEG1 Antibody

  • aortic preferentially expressed gene 1
  • Aortic preferentially expressed protein 1
  • APEG1
  • BPEG
  • EC 2.7.11
  • EC
  • KIAA1297APEG-1
  • MGC12676
  • nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury
  • SPEG complex locus
  • SPEGalpha
  • SPEGbeta
  • striated muscle preferentially expressed protein kinase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for APEG1 Antibody (NBP1-90134)(1)

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for APEG1 Antibody (NBP1-90134) (0)

There are no reviews for APEG1 Antibody (NBP1-90134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APEG1 Antibody (NBP1-90134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional APEG1 Products

Bioinformatics Tool for APEG1 Antibody (NBP1-90134)

Discover related pathways, diseases and genes to APEG1 Antibody (NBP1-90134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APEG1 Antibody (NBP1-90134)

Discover more about diseases related to APEG1 Antibody (NBP1-90134).

Pathways for APEG1 Antibody (NBP1-90134)

View related products by pathway.

PTMs for APEG1 Antibody (NBP1-90134)

Learn more about PTMs related to APEG1 Antibody (NBP1-90134).

Research Areas for APEG1 Antibody (NBP1-90134)

Find related products by research area.

Blogs on APEG1

There are no specific blogs for APEG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APEG1 Antibody and receive a gift card or discount.


Gene Symbol SPEG