APEG1 Antibody - BSA Free

Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Analysis in human skeletal muscle and liver tissues using NBP1-90134 antibody. Corresponding SPEG RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining of human endometrium shows strong membranous positivity in stromal cells.

Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: APEG1 Antibody [NBP1-90134] - Staining of human skeletal muscle shows moderate membranous positivity in striated muscle fibers.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APEG1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV
• Predicted Species: Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPEG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 25087613)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  APEG1 Protein (NBP1-90134PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APEG1 Antibody - BSA Free

• aortic preferentially expressed gene 1
• Aortic preferentially expressed protein 1
• APEG1
• BPEG
• EC 2.7.11
• EC 2.7.11.1
• KIAA1297APEG-1
• MGC12676
• nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury
• SPEG complex locus
• SPEGalpha
• SPEGbeta
• striated muscle preferentially expressed protein kinase

Background

Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APEG1 Antibody (NBP1-90134)(1)

Publication using NBP1-90134

• Agrawal PB, Pierson CR, Joshi M et al. SPEG Interacts with Myotubularin, and Its Deficiency Causes Centronuclear Myopathy with Dilated Cardiomyopathy. Am J Hum Genet 2014-08-07 [PMID: 25087613] (ICC/IF)

Bioinformatics

• Gene Symbol: SPEG
• Entrez:
  • 10290(Human)
• Uniprot:
  • Q15772(Human)