APE Antibody (3E12.)

Images

 
Sandwich ELISA: APE Antibody (3E12) [H00000328-M05] - Detection limit for recombinant GST tagged APEX1 is 0.1 ng/ml as a capture antibody.
Immunoprecipitation: APE Antibody (3E12) [H00000328-M05] - Analysis of APEX1 transfected lysate using anti-APEX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APEX1 rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
3E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

APE Antibody (3E12.) Summary

Immunogen
APEX1 (AAH02338, 1 a.a. - 318 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
APEX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA.
Antagonist

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for APE Antibody (3E12.)

  • AP endonuclease 1
  • APE
  • APE1
  • APE-1
  • APEAPEX nuclease (multifunctional DNA repair enzyme)
  • APENAP endonuclease class I
  • APEX deoxyribonuclease (apurinic or apyrimidinic)
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • APEX nuclease
  • APEX1
  • Apurinic-apyrimidinic endonuclease 1
  • APXAP lyase
  • DNA-(apurinic or apyrimidinic site) lyase
  • EC 3.1
  • EC 4.2.99.18
  • HAP1apurinic/apyrimidinic (abasic) endonuclease
  • multifunctional DNA repair enzyme
  • protein REF-1
  • redox factor 1
  • Redox factor-1
  • REF1 apurinic/apyrimidinic exonuclease
  • REF-1

Background

The mammalian apurinic/apyrimidinic endonuclease (APE/ref-1) is responsible for the repair of AP sites in DNA. In addition, this enzyme functions as a redox factor facilitating the DNA binding capability of FOS, JUN, NfkB, HIF-1 alpha, Pax-5, Pax-8 and other transcription factors. APE/ref-1 has also been shown to control p53 activity through redox alteration. APE is linked to apoptosis, associated with thioredoxin, and altered levels of APE/ref-1 have been found in some cancers. APE appears to form a unique link between the DNA base excision pathway, oxidative signaling, transcription regulation, cancer and cell-cycle control.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
H00000328-M05
Species: Hu
Applications: ELISA, IP

Publications for APE Antibody (H00000328-M05) (0)

There are no publications for APE Antibody (H00000328-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APE Antibody (H00000328-M05) (0)

There are no reviews for APE Antibody (H00000328-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APE Antibody (H00000328-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APE Products

Bioinformatics Tool for APE Antibody (H00000328-M05)

Discover related pathways, diseases and genes to APE Antibody (H00000328-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APE Antibody (H00000328-M05)

Discover more about diseases related to APE Antibody (H00000328-M05).
 

Pathways for APE Antibody (H00000328-M05)

View related products by pathway.

PTMs for APE Antibody (H00000328-M05)

Learn more about PTMs related to APE Antibody (H00000328-M05).
 

Research Areas for APE Antibody (H00000328-M05)

Find related products by research area.

Blogs on APE

There are no specific blogs for APE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APE Antibody (3E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol APEX1
Entrez
Uniprot