Annexin A2 Antibody (1W2B5)

Western Blot: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Western blot analysis of extracts of various cell lines, using Annexin A2 Rabbit mAb (NBP3-15360) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded mouse testis using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded rat ovary using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Annexin A2 Antibody (1W2B5) [NBP3-15360] - Immunohistochemistry of paraffin-embedded human esophageal using Annexin A2 Rabbit mAb (NBP3-15360) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Annexin A2 Antibody (1W2B5) [Annexin A2] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Annexin A2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 1W2B5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Annexin A2 Antibody (1W2B5) Summary

• Description: Novus Biologicals Rabbit Annexin A2 Antibody (1W2B5) (NBP3-15360) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355). MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ANXA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Annexin A2 Antibody (1W2B5)

• Annexin A2
• Annexin II
• annexin-2
• ANX2
• ANX2L4
• ANX2L4LPC2
• ANXA2
• CAL1H
• Calpactin I heavy chain
• calpactin I heavy polypeptide
• Calpactin-1 heavy chain
• chromobindin 8
• chromobindin-8
• LIP2
• LIP2PAP-IV
• Lipocortin II
• Lipocortin-2
• LPC2D
• LPC2DP36
• p36
• PAP-IV
• Placental anticoagulant protein IV
• Protein I

Background

The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin II is a calcium regulated, membrane binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA2