Annexin A10 Antibody - BSA Free

Western Blot: Annexin A10 Antibody [NBP3-16992] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunocytochemistry/Immunofluorescence: Annexin A10 Antibody [NBP3-16992] - Analysis in human stomach and rectum tissues using Anti-ANXA10 antibody. Corresponding ANXA10 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP3-16992] - Staining of human stomach shows high expression.

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP3-16992] - Staining of human rectum shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Annexin A10 Antibody - BSA Free (NBP3-16992) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDLREQLSDHFKDVMAG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Annexin A10 Antibody - BSA Free

• annexin 14
• Annexin A10
• annexin-10
• annexin-14
• ANX14
• ANX14Annexin-10
• ANXA10

Background

Annexin A10 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA10