Annexin A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Analysis in human esophagus and cerebral cortex tissues. Corresponding ANXA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human colon, esophagus, lung and lymph node using Anti-Annexin A1 antibody NBP1-90162 (A) shows similar protein distribution across tissues to independent antibody NBP1-90161 (B).

Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis using Anti-ANXA1 antibody NBP1-90162 (A) shows similar pattern to independent antibody NBP1-90161 (B).

Immunocytochemistry/Immunofluorescence: Annexin A1 Antibody [NBP1-90162] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.

Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human lung shows strong positivity in macrophages.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human lymph node shows moderate to strong positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human esophagus shows moderate to strong positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human colon shows moderate positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human cerebral cortex shows no positivity in neurons as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Annexin A1 Protein (NBP1-90162PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23920108)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A1 Antibody - BSA Free

• Annexin A1
• annexin I (lipocortin I)
• Annexin I
• Annexin-1
• ANX1
• ANXA1
• Calpactin II
• calpactin-2
• chromobindin-9
• Lipocortin I
• LPC1
• LPC1annexin-1
• p35
• Phospholipase A2 inhibitory protein

Background

Annexin I, also known as Annexin A1, belongs to the annexin family of calcium dependent phospholipid binding proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Annexin A1 Antibody (NBP1-90162)(2)

Publications using NBP1-90162

• Herrera-López EE, Guerrero-Escalera D, Aguirre-Maldonado I et al. Annexins A2 and A5 are potential early biomarkers of hepatocarcinogenesis Scientific reports 2023-04-28 [PMID: 37117324]
• Andersson S, Konrad A, Ashok N et al. Antibodies Biotinylated Using a Synthetic Z-domain from Protein A Provide Stringent In Situ Protein Detection. J Histochem Cytochem 2013-11-01 [PMID: 23920108]

Bioinformatics

• Gene Symbol: ANXA1