Annexin A1 Antibody

Images

 
Independent Antibodies: Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis using Anti-ANXA1 antibody NBP1-90162 (A) shows similar pattern to independent antibody NBP1-90161 (B).
Immunocytochemistry/ Immunofluorescence: Annexin A1 Antibody [NBP1-90162] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human colon, esophagus, lung and lymph node using Anti-ANXA1 antibody NBP1-90162(A) shows similar protein ...read more
Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Genetic Strategies: Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Analysis in human esophagus and cerebral cortex tissues. Corresponding ANXA1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human lung shows strong positivity in macrophages.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human lymph node shows moderate to strong positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human esophagus shows moderate to strong positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human colon shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
Specificity
Specificity of human Annexin A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Annexin A1 Knockout HeLa Cell Lysate
Control Peptide
Publications
Read Publication using NBP1-90162.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23920108)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin A1 Antibody

  • Annexin A1
  • annexin I (lipocortin I)
  • Annexin I
  • Annexin-1
  • ANX1
  • ANXA1
  • Calpactin II
  • calpactin-2
  • chromobindin-9
  • Lipocortin I
  • LPC1
  • LPC1annexin-1
  • p35
  • Phospholipase A2 inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1916
Species: Hu
Applications: WB, IHC, ICC
AF7250
Species: Hu
Applications: IHC
409-ML/CF
Species: Mu
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Annexin A1 Antibody (NBP1-90162)(1)

Reviews for Annexin A1 Antibody (NBP1-90162) (0)

There are no reviews for Annexin A1 Antibody (NBP1-90162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin A1 Antibody (NBP1-90162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Annexin A1 Products

Bioinformatics Tool for Annexin A1 Antibody (NBP1-90162)

Discover related pathways, diseases and genes to Annexin A1 Antibody (NBP1-90162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A1 Antibody (NBP1-90162)

Discover more about diseases related to Annexin A1 Antibody (NBP1-90162).
 

Pathways for Annexin A1 Antibody (NBP1-90162)

View related products by pathway.

PTMs for Annexin A1 Antibody (NBP1-90162)

Learn more about PTMs related to Annexin A1 Antibody (NBP1-90162).
 

Research Areas for Annexin A1 Antibody (NBP1-90162)

Find related products by research area.

Blogs on Annexin A1

There are no specific blogs for Annexin A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA1