Annexin A1 Antibody

Images

 
Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: Annexin A1 Antibody [NBP1-90162] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in human cell line A-549.
Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

Annexin A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Annexin A1 Protein (NBP1-90162PEP)
Publications
Read Publication using NBP1-90162.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23920108)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin A1 Antibody

  • Annexin A1
  • annexin I (lipocortin I)
  • Annexin I
  • Annexin-1
  • ANX1
  • ANXA1
  • Calpactin II
  • calpactin-2
  • chromobindin-9
  • Lipocortin I
  • LPC1
  • LPC1annexin-1
  • p35
  • Phospholipase A2 inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF7250
Species: Hu
Applications: IHC
409-ML/CF
Species: Mu
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP

Publications for Annexin A1 Antibody (NBP1-90162)(1)

Reviews for Annexin A1 Antibody (NBP1-90162) (0)

There are no reviews for Annexin A1 Antibody (NBP1-90162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin A1 Antibody (NBP1-90162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A1 Products

Bioinformatics Tool for Annexin A1 Antibody (NBP1-90162)

Discover related pathways, diseases and genes to Annexin A1 Antibody (NBP1-90162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A1 Antibody (NBP1-90162)

Discover more about diseases related to Annexin A1 Antibody (NBP1-90162).
 

Pathways for Annexin A1 Antibody (NBP1-90162)

View related products by pathway.

PTMs for Annexin A1 Antibody (NBP1-90162)

Learn more about PTMs related to Annexin A1 Antibody (NBP1-90162).
 

Research Areas for Annexin A1 Antibody (NBP1-90162)

Find related products by research area.

Blogs on Annexin A1

There are no specific blogs for Annexin A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA1
Entrez