Annexin A1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Analysis in human esophagus and cerebral cortex tissues. Corresponding ANXA1 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human colon, esophagus, lung and lymph node using Anti-Annexin A1 antibody NBP1-90162 (A) shows similar ...read more
Genetic Strategies: Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative ...read more
Independent Antibodies: Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis using Anti-ANXA1 antibody NBP1-90162 (A) shows similar pattern to independent antibody NBP1-90161 (B).
Immunocytochemistry/ Immunofluorescence: Annexin A1 Antibody [NBP1-90162] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Western Blot: Annexin A1 Antibody [NBP1-90162] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human lung shows strong positivity in macrophages.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human lymph node shows moderate to strong positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human esophagus shows moderate to strong positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human colon shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90162] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Annexin A1 Protein (NBP1-90162PEP)
Publications
Read Publication using NBP1-90162.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23920108)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin A1 Antibody

  • Annexin A1
  • annexin I (lipocortin I)
  • Annexin I
  • Annexin-1
  • ANX1
  • ANXA1
  • Calpactin II
  • calpactin-2
  • chromobindin-9
  • Lipocortin I
  • LPC1
  • LPC1annexin-1
  • p35
  • Phospholipase A2 inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
AF7250
Species: Hu
Applications: IHC
409-ML/CF
Species: Mu
Applications: BA
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
1887-ML/CF
Species: Mu
Applications: BA
DY1857
Species: Mu
Applications: ELISA
NBP1-31650
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP1-90162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Annexin A1 Antibody (NBP1-90162)(1)

Reviews for Annexin A1 Antibody (NBP1-90162) (0)

There are no reviews for Annexin A1 Antibody (NBP1-90162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin A1 Antibody (NBP1-90162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Annexin A1 Products

Bioinformatics Tool for Annexin A1 Antibody (NBP1-90162)

Discover related pathways, diseases and genes to Annexin A1 Antibody (NBP1-90162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A1 Antibody (NBP1-90162)

Discover more about diseases related to Annexin A1 Antibody (NBP1-90162).
 

Pathways for Annexin A1 Antibody (NBP1-90162)

View related products by pathway.

PTMs for Annexin A1 Antibody (NBP1-90162)

Learn more about PTMs related to Annexin A1 Antibody (NBP1-90162).
 

Research Areas for Annexin A1 Antibody (NBP1-90162)

Find related products by research area.

Blogs on Annexin A1

There are no specific blogs for Annexin A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA1